Dataset for protein classical BH3-containing proteins of organism Peromyscus maniculatus bairdii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                .               
---------------------------Makqrsdvss----eg-----------g------qlrpaars----pelr---
mpgagvfwkqyravrrgllsrqlapaaastapqplrdpcdr--vrksdpgirsl-sdaggrrwqtveqpqvqrsqvetxx
                            grpklmalaeahalelardg rpfprqaprvlvlik slhdmfpicpfaels
                            pes------rrsv  f p f iecg        tav n v whhwagac   
                             alartta  epp                      d g p naad       
                                 eg                                e            
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                  *                                             
----------------------------------Pgaptslqtepr---------d--p-l-------------------
xxxxxxxxxxxxxxxxxxxxxxxxxxxalggprw seqemssrveqglgpsftgl-rg-y-epgnlvalrlqygqaanss
wsh                                egmsdke-adepnyspvredqlaectadrlqlnighaqigqltrp
                                    farqrrp---lepdvrqdp itavgs qspgsppaspqsf dc 
                                      apppcigdkdi gggpg ge h q  g   ad fa p     
                                           g  e d a c e  c g                    
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                    :   . .                                     
------------------------drspapmsrdrstqtpsppeqafgvylsa---------------------------
hhrlqvrrstllsrsssgyfsfdtggmglmltcsklssysgitchsenheyeqgvteepqrlfygnagyrlplpasfpag
psfiflfplshccg          qevdscerspsharllagamerlatteql                           
ll                      pplrprsqqkla pv  a spdqdlptpc                           
                        a  lgikaeh e  s    pdla gmd                             
                              a             a                                   
                                                                                
                                                                                

       250       260       270       280       290       300       310         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
                        .                                                      
mp-rgqsrslp-------ri--elrrigdefn-s---r-----h---p-----qll-f-llllwrrh------------
t-v-r---ee-anlrpeq--gr-iqgmtnlren-ytr-vpteq-whl-qmarl--fr-vi--vlllglnalrlqpqqvt
sgsi-vfq-awpdvwaaiqyaqqa kls--l-giwswlrrapgtpvhtdqvigmy-pmf-rvw ---ggrpgstlnl  
vafverppd-qwthk rve hgk  c-a q-heqfkg pqpqdartrrsrwwwevwlrsqssp qvqpekismlfw   
l lg gee gcer    e   ad    - k  a  e  lhiks qqn  prqvasntnmgqpn pkne fgekg s   
a g         q                d          e   g a     s e a l n f n l   e ae     
                                                          i   a d e            
                                                                c d            
© 1998-2023Legal notice