Dataset for protein classical BH3-containing proteins of organism Peromyscus maniculatus bairdii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                       :                 :                                      
--------------makspsrlsap-draggvlqpaerppqlr------------pga----------------------
mpgagvfwkqyrav--tqkqdvlsecaleltqrkdqpprrpvgrigdklysarcesdvptslqterqexxxxxxxxxxxx
              rgrpeapqm rsnhikllahsdvgiss a            rlptsvvscglcaprvlvtldpgae
               rmlr epn  aeavwae tt-sfaf  e            faisfpieem               
               pgaq  g     p e a r g   a                   aa a                 
                  l          a   a                                              
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------p---p---------------------r--------l-----pqdrs
xxxxxxxxxxxxxxxxxpmggrrwrpapqsmpqi-emk-sgqepsstpvrdlgpsftldq-nsyllrgl-gyighqmgqa
pwhhdseaetlswsqpneleppqgvrgargsfrg sfeepepqdnisadag dlaecgedpgqvaapsssanfsdeg-lc
             phggad  gecpgelhdrvfq ldr dvtgegalrs   saqsqfvr spr slfp thccg--r-p
                        dec e d     ap ase  f  l    f l i  c l l q        fdtlk 
                                     g                                          
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                  :  *                                                          
pasms----------drstqtPsppeqdl-------------------------nhylsampvrgqsre-p-------ri
lsp--cggvgametrsklssy aitceafmlpcgvteepqrlfygnagyrlplpgvtyeqtgsir----e-anvraeqvy
arqshh         p-haps ggashre                         atee-lsdlcerlqsawpdlwpaiqf
rn atq         -tr ll tsdmalv                         e---q--afvvtpprrqwrhgdkvnn
ik eqk         hlq  v  a   ga                          sptagl gg gekpgeqqi   lkl
    d          a e                                     gfp  a e    e    i     e 
                                                                                

       250       260       270       280       290       
....:....|....:....|....:....|....:....|....:....|....:..
                                                         
grelrrmtdefensyt-r-----h---p-----qll-f-lll-w-r-----------
aqli-gisnlrnglw-r-vpteq-whl-qmarl--fr-vi--vlr-hggalrlqpqq
wsk-q-lg--l-eifswlrrapgtpvhtdqvigmy-pmf-rvl-llgperpgstlw 
r-- ln-asq-h---kg pqpqdartrrsrwwwevwlrsqssw pvqlnkgemg s 
 aq  cf- k frqve    iks qqn  prqvasntnmgqpp n ne  e ae n 
       i d  a h     e   g a     s e a l n f d e          
                                      i   a c d          
© 1998-2022Legal notice