Dataset for protein classical BH3-containing proteins of organism Peromyscus maniculatus bairdii

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A6I9LHF8_BMF-01       MPGAGVFWKQYRAVRRGLLSRQLAPAAAAALARTTASRRSPLE-------
A0A6I9LW27_BCL2L11      --------------MAKQPSDVSSECDREGGQLQPAERPPQLR-------
A0A6J0DIY6_PMAIP1-      --------------MPRSQARPNAPSNAAWAELAP-EFAAQLRRIGDKLY
A0A6I9LKH4_BIK-01       ----------------MSEARLMAR-DLIKTVLHDQVPRPPVA-------
A0A8C8U1G0_BIK-01       ----------------MSEARLMAR-DLIKTVLHDQVPRPPVA-------
A0A6I9LW27_BCL2L11      --------------MAKQPSDVSSECDREGGQLQPAERPPQLR-------
A0A6I9LQL5_BAD-01       --------------MGTPKQPLLAP-AHALGVRKSDPGIRSLG-------
A0A6I9LQL5_BAD-02       --------------MGTPKQPLLAP-AHALGVRKSDPGIRSLG-------
A0A6I9LW27_BCL2L11      --------------MAKQPSDVSSECDREGGQLQPAERPPQLR-------
A0A8C8TKK3_BBC3-01      --------------MARARQEGSSP-EPVEGLARDGPRPFPLG-------
                                               :                 :        

A0A6I9LHF8_BMF-01       -----FAPSFPIECGRQAPRVLVTLDPGAEPWHHDSEAETLSWSHPGEME
A0A6I9LW27_BCL2L11      -----PGAPTSLQTE-----------------------------------
A0A6J0DIY6_PMAIP1-      SARCEPDITAVLAEM-----------------------------------
A0A6I9LKH4_BIK-01       -----PGA------------------------------------------
A0A8C8U1G0_BIK-01       -----PGA------------------------------------------
A0A6I9LW27_BCL2L11      -----PGAPTSLQTE-----------------------------------
A0A6I9LQL5_BAD-01       -----SDA-----------------------------------------G
A0A6I9LQL5_BAD-02       -----SDA-----------------------------------------G
A0A6I9LW27_BCL2L11      -----PGAPTSLQTE----------------------------PQGNPDG
A0A8C8TKK3_BBC3-01      -----RLVPSAVSCGLCEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXALG
                                                                          

A0A6I9LHF8_BMF-01       PPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPL
A0A6I9LW27_BCL2L11      --------------------------------------------------
A0A6J0DIY6_PMAIP1-      --------------------------------------------------
A0A6I9LKH4_BIK-01       --------------PSMKEPVEEENISPVRDLDLAECLEDRNQVALR--L
A0A8C8U1G0_BIK-01       --------------PSMKE--------PVRDLDLAECLEDRNQVALR--L
A0A6I9LW27_BCL2L11      --------------------------------------------------
A0A6I9LQL5_BAD-01       GRRWRPAAQSMFQIPEFEPSEQEDSSTADRGLGPSFTGDQRGPYLAPGLL
A0A6I9LQL5_BAD-02       GRRWRPAAQSMFQIPEFEPSEQEDSSTADRGLGPSFTGDQRGPYLAPGLL
A0A6I9LW27_BCL2L11      GGEGDRCPHGSPQGPLAPPASPGPFATR----SPLFIFVRRSSLLSRSSS
A0A8C8TKK3_BBC3-01      GPRWPGGPRSRPRGP--RPDGPQP--------------------------
                                                                          

A0A6I9LHF8_BMF-01       THCCGPGLRPISQEDK---------ATQTLSPASPSQGVMLPCGVTEEPQ
A0A6I9LW27_BCL2L11      -----PQDRSPAPMSC---------DKSTQTPSPPCQAF-----------
A0A6J0DIY6_PMAIP1-      -----PGRKARKSAT------------RSSSPTPDSEDL-----------
A0A6I9LKH4_BIK-01       AYIGDEMDLCLRS------------PRLAQLPGIAMHRL-----------
A0A8C8U1G0_BIK-01       AYIGDEMDLCLRS------------PRLAQLPGIAMHRL-----------
A0A6I9LW27_BCL2L11      -----PQDRSPAPMSC---------DKSTQTPSPPCQAF-----------
A0A6I9LQL5_BAD-01       GNIGHQQGQAANSSHHGGVGAMETRSRHSSYPAGTEEDE-----------
A0A6I9LQL5_BAD-02       GNIGHQQGQAANSSHHGGVGAMETRSRHSSYPAGTEEDE-----------
A0A6I9LW27_BCL2L11      GYFSFDTDRSPAPMSC---------DKSTQTPSPPCQAF-----------
A0A8C8TKK3_BBC3-01      ---------SLSPAQQ---------HLESPVPSAPEALA-----------
                                                    :  *                  

A0A6I9LHF8_BMF-01       RLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQ
A0A6I9LW27_BCL2L11      --------------NHYLSAMDLCETLKPREQIHGDAQKNW---------
A0A6J0DIY6_PMAIP1-      --------------E------DECVQLRR----IGDKLNLWQKLLNFISK
A0A6I9LKH4_BIK-01       --------------AVTYSQTGVRG-------------VFRSLIRGLTNL
A0A8C8U1G0_BIK-01       --------------AVTYSQTGVRG-------------VFRSLIRGLTNL
A0A6I9LW27_BCL2L11      --------------NHYLSAMASIRQSQEEPADVRPEIRIAQELRRIGDE
A0A6I9LQL5_BAD-01       --------------GTEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDE
A0A6I9LQL5_BAD-02       --------------GTEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDE
A0A6I9LW27_BCL2L11      --------------NHYLSAMASIRQSQEEPADVRPEIRIAQELRRIGDE
A0A8C8TKK3_BBC3-01      --------------GGPTQAAPGVRGEEEEWAR-----EIGAQLRRMADD
                                                                          

A0A6I9LHF8_BMF-01       FHRLH-----IQQHQQNRDRAWWQVFLFLQNLALNREENREGAGPW-
A0A6I9LW27_BCL2L11      -----------------------------------------------
A0A6J0DIY6_PMAIP1-      LFNLVT-----------------------------------------
A0A6I9LKH4_BIK-01       RENIWSWRVPTPGTWVLPDQARGQLFPMVLLVLLLLGGEALRLQLQ-
A0A8C8U1G0_BIK-01       RENIWSWRVPTPGTWVLPDQARGQLFPMVLLVLLLLGGEALRLQLQ-
A0A6I9LW27_BCL2L11      FNESYTRR--AEDHPHHPQMVILQLLRFFIRLVWRRH----------
A0A6I9LQL5_BAD-01       FEGSFKG----------------EELANSLSPFWCVQ----------
A0A6I9LQL5_BAD-02       FEGSFKGLPRPKSAGTATQMRQSASWTRIIQSWWDRNLGKGGSTPSQ
A0A6I9LW27_BCL2L11      FNESYTRR--AEDHPHHPQMVILQLLRFFIRLVWRRH----------
A0A8C8TKK3_BBC3-01      LNAQYERRRQEEQHRHRPSPWRVMYNLFMGLLPLPRDPGAPEMEPN-
                                                                       

© 1998-2022Legal notice