Dataset for protein classical BH3-containing proteins of organism Peromyscus maniculatus bairdii

[Download (right click)] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A6I9LQL5_BAD-02          MGTPK---------------------------------------------
A0A6I9LQL5_BAD-01          MGTPK---------------------------------------------
A0A6I9LW27_BCL2L11-01      MAKQP---------------------------------------------
A0A6I9LW27_BCL2L11-03      MAKQP---------------------------------------------
A0A6I9LHF8_BMF-01          MPGAGVFWKQYRAVRRGLLSRQLAPAAAAALARTTASRRSPLEFAPSFPI
A0A6I9LKH4_BIK-01          MSEARLMA-------RDLIKTVL---------------------------
A0A8C8TKK3_BBC3-01         MARAR---------------------------------------------
A0A6J0DIY6_PMAIP1-01       MPRSQ---------------------------------------------
A0A6I9LW27_BCL2L11-02      MAKQP---------------------------------------------
A0A8C8U1G0_BIK-01          MSEARLMA-------RDLIKTVL---------------------------
                           *                                                 

A0A6I9LQL5_BAD-02          ----------Q--PLLAPAHALGVR-------------------KSDPGI
A0A6I9LQL5_BAD-01          ----------Q--PLLAPAHALGVR-------------------KSDPGI
A0A6I9LW27_BCL2L11-01      ----------S--DVSSECDREG-G-------------------Q-----
A0A6I9LW27_BCL2L11-03      ----------S--DVSSECDREG-G-------------------Q-----
A0A6I9LHF8_BMF-01          ECGRQAPRVLVTLDPGAEPWH-HDSEAETLSWSHPGEMEPPQCVEELEDD
A0A6I9LKH4_BIK-01          --HDQVPRPPV--APGAPSMK-EPVEEENISPV--RDLDLAECLEDRNQV
A0A8C8TKK3_BBC3-01         ----------Q--EGSSPEPVEGLA-------------------RDGPRP
A0A6J0DIY6_PMAIP1-01       ----------A--RPNAPSNA-AWA-------------------ELAPEF
A0A6I9LW27_BCL2L11-02      ----------S--DVSSECDREG-G-------------------Q-----
A0A8C8U1G0_BIK-01          --HDQVPRPPV--APGAPSMK-EP--------V--RDLDLAECLEDRNQV
                                           :                           .     

A0A6I9LQL5_BAD-02          RSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDSSTADRGLGPSFTGDQRG
A0A6I9LQL5_BAD-01          RSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDSSTADRGLGPSFTGDQRG
A0A6I9LW27_BCL2L11-01      -------------------------------------------LQPAERP
A0A6I9LW27_BCL2L11-03      -------------------------------------------LQPAERP
A0A6I9LHF8_BMF-01          V------------------------------------------FQPEDGE
A0A6I9LKH4_BIK-01          A------------------------------------------LRLA---
A0A8C8TKK3_BBC3-01         F------------------------------------------PLGR---
A0A6J0DIY6_PMAIP1-01       A------------------------------------------AQLR---
A0A6I9LW27_BCL2L11-02      -------------------------------------------LQPAERP
A0A8C8U1G0_BIK-01          A------------------------------------------LRLA---
                                                                             

A0A6I9LQL5_BAD-02          PYLAPGLLGNIGHQ-------------------QGQAANSSHHGGVGAME
A0A6I9LQL5_BAD-01          PYLAPGLLGNIGHQ-------------------QGQAANSSHHGGVGAME
A0A6I9LW27_BCL2L11-01      PQLRPGAPTSLQTEPQGNPDGGGEGDRCPHGSPQGPLAPPAS---PGPFA
A0A6I9LW27_BCL2L11-03      PQLRPGAPTSLQTEPQ----------------------------------
A0A6I9LHF8_BMF-01          PGTQPGSLLSADLFAQ----------------------------------
A0A6I9LKH4_BIK-01          -------------YIG----------------------------------
A0A8C8TKK3_BBC3-01         -------------LVP----------------------------------
A0A6J0DIY6_PMAIP1-01       -------------RIG----------------------------------
A0A6I9LW27_BCL2L11-02      PQLRPGAPTSLQTEPQ----------------------------------
A0A8C8U1G0_BIK-01          -------------YIG----------------------------------
                                                                             

A0A6I9LQL5_BAD-02          TRS-------------------RH--------------------------
A0A6I9LQL5_BAD-01          TRS-------------------RH--------------------------
A0A6I9LW27_BCL2L11-01      TRSPLFIFVRRSSLLS------RSSSG----------------------Y
A0A6I9LW27_BCL2L11-03      --------------------------------------------------
A0A6I9LHF8_BMF-01          --------SQLDCPLS------RLQLF----------------------P
A0A6I9LKH4_BIK-01          --------DEMDLCLRSP----RLAQL-----------------------
A0A8C8TKK3_BBC3-01         --------SAVSCGLCEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXALGG
A0A6J0DIY6_PMAIP1-01       --------DKLYSARCEPDITAVLAEM-----------------------
A0A6I9LW27_BCL2L11-02      --------------------------------------------------
A0A8C8U1G0_BIK-01          --------DEMDLCLRSP----RLAQL-----------------------
                                                                             

A0A6I9LQL5_BAD-02          -----SSYPAGTE--ED--------------------------EGTEEEL
A0A6I9LQL5_BAD-01          -----SSYPAGTE--ED--------------------------EGTEEEL
A0A6I9LW27_BCL2L11-01      FSFDTDRSPAPMS--CD--------------------------KSTQTPS
A0A6I9LW27_BCL2L11-03      -----DRSPAPMS--CD--------------------------KSTQTPS
A0A6I9LHF8_BMF-01          LTHCCGPGLRPISQ-ED--------------------------KATQTLS
A0A6I9LKH4_BIK-01          ---P-GIAMHRLAVTYSQTGVRGVFRSLIRGLTNLRENIWSWRVPTPGT-
A0A8C8TKK3_BBC3-01         PRWPGGPRSRPRGPRPD--------------------------GPQPSLS
A0A6J0DIY6_PMAIP1-01       ---P-GRKARKSATRSS--------------------------SPTPDS-
A0A6I9LW27_BCL2L11-02      -----DRSPAPMS--CD--------------------------KSTQTPS
A0A8C8U1G0_BIK-01          ---P-GIAMHRLAVTYSQTGVRGVFRSLIRGLTNLRENIWSWRVPTPGT-
                                .          .                                 

A0A6I9LQL5_BAD-02          SPFRG----------------------------------------RSRSA
A0A6I9LQL5_BAD-01          SPFRG----------------------------------------RSRSA
A0A6I9LW27_BCL2L11-01      PPCQA----------------------------FNHYLSAMASIRQSQEE
A0A6I9LW27_BCL2L11-03      PPCQA----------------------------FNHYLSAMDLCE-----
A0A6I9LHF8_BMF-01          PASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQ
A0A6I9LKH4_BIK-01          ------------------------------------------------WV
A0A8C8TKK3_BBC3-01         PAQQHLE----SPVPSAPEAL------------AGGPTQAAPGVRGEEEE
A0A6J0DIY6_PMAIP1-01       ------------------------------------------------ED
A0A6I9LW27_BCL2L11-02      PPCQA----------------------------FNHYLSAMASIRQSQEE
A0A8C8U1G0_BIK-01          ------------------------------------------------WV
                                                                             

A0A6I9LQL5_BAD-02          PPNLWAAQRYGRELRRMSDEFEGSFKGL----PRPKSAGTATQMRQSASW
A0A6I9LQL5_BAD-01          PPNLWAAQRYGRELRRMSDEFEGSFKGE----ELANSLSP----------
A0A6I9LW27_BCL2L11-01      PADVRPEIRIAQELRRIGDEFNESYTRRA-EDHPHHPQMV-----ILQLL
A0A6I9LW27_BCL2L11-03      -----------------------TLKPRE-QIHGD---------------
A0A6I9LHF8_BMF-01          W-QHR----AEVQIARKLQCIADQFHRLHIQQHQQNRDRA-----WWQVF
A0A6I9LKH4_BIK-01          L--PD----QAR-----------------------GQL-----------F
A0A8C8TKK3_BBC3-01         W-ARE----IGAQLRRMADDLNAQYERRRQEEQHRHRPSP-----WRVMY
A0A6J0DIY6_PMAIP1-01       L--ED----ECVQLRRIGDKLNL----------------------WQKLL
A0A6I9LW27_BCL2L11-02      PADVRPEIRIAQELRRIGDEFNESYTRRA-EDHPHHPQMV-----ILQLL
A0A8C8U1G0_BIK-01          L--PD----QAR-----------------------GQL-----------F
                                                                             

A0A6I9LQL5_BAD-02          TRIIQSWW-D-RNLGKGGSTPSQ
A0A6I9LQL5_BAD-01          ------FW------------CVQ
A0A6I9LW27_BCL2L11-01      RFFIRL------------VWRRH
A0A6I9LW27_BCL2L11-03      ------------------AQKNW
A0A6I9LHF8_BMF-01          -LFLQNLALN-REENRE-GAGPW
A0A6I9LKH4_BIK-01          P--MVLLVLLLLGGEAL-RLQLQ
A0A8C8TKK3_BBC3-01         NLFMGLLPLP-RDPGAP-EMEPN
A0A6J0DIY6_PMAIP1-01       NFISKLFNLV------------T
A0A6I9LW27_BCL2L11-02      RFFIRL------------VWRRH
A0A8C8U1G0_BIK-01          P--MVLLVLLLLGGEAL-RLQLQ
                                                  

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice