Dataset for protein classical BH3-containing proteins of organism Peromyscus maniculatus bairdii

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A6I9LHF8_BMF-01       MPGAGVFWKQYRAVRRGLLSRQLAPAAAAALARTTASRRSPLEFAPSFPI
A0A6I9LKH4_BIK-01       ---------------------------MSEARLMARD-------------
A0A8C8U1G0_BIK-01       ---------------------------MSEARLMARD-------------
A0A6J0DIY6_PMAIP1-      ---------------------------MPRS-------------------
A0A6I9LQL5_BAD-01       ---------------------------MGTPKQPLLAPAHALGVRKSDPG
A0A6I9LQL5_BAD-02       ---------------------------MGTPKQPLLAPAHALGVRKSDPG
A0A8C8TKK3_BBC3-01      ---------------------------MARARQEGSSPEPVEGLARDGPR
A0A6I9LW27_BCL2L11      ---------------------------MAKQPSDVSSECDREG-------
A0A6I9LW27_BCL2L11      ---------------------------MAKQPSDVSSECDREG-------
A0A6I9LW27_BCL2L11      ---------------------------MAKQPSDVSSECDREG-------
                                                                          

A0A6I9LHF8_BMF-01       ECGRQAPRVLVTLDPGAEPWHHDSEAETLSWSH-----------------
A0A6I9LKH4_BIK-01       -----------LIKTVLHDQVPRPPVA-----------------------
A0A8C8U1G0_BIK-01       -----------LIKTVLHDQVPRPPVA-----------------------
A0A6J0DIY6_PMAIP1-      -----------QARPNAPSNAAWAELA-----------------------
A0A6I9LQL5_BAD-01       IRSLGSDAGGRRWRPAAQSMFQIPEFE-----------------------
A0A6I9LQL5_BAD-02       IRSLGSDAGGRRWRPAAQSMFQIPEFE-----------------------
A0A8C8TKK3_BBC3-01      PFPLG------RLVPSAVS----CGLCEXXXXXXXXXXXXXXXXXXXXXX
A0A6I9LW27_BCL2L11      ----G------QLQPAERP----PQLR-----------------------
A0A6I9LW27_BCL2L11      ----G------QLQPAERP----PQLR-----------------------
A0A6I9LW27_BCL2L11      ----G------QLQPAERP----PQLR-----------------------
                                      .                                   

A0A6I9LHF8_BMF-01       --------------PGEMEPPQCVEELEDDVFQPEDGEPGTQPGSLLSAD
A0A6I9LKH4_BIK-01       --------------PGAPSMKEPVEEENISPVRDLDLAECLEDRNQVALR
A0A8C8U1G0_BIK-01       --------------PGAPSMKE--------PVRDLDLAECLEDRNQVALR
A0A6J0DIY6_PMAIP1-      --------------PEFAAQLRRIGDKLYSARCEPDITAVL---------
A0A6I9LQL5_BAD-01       --------------PSEQEDSSTADRGLGPSFTGDQRGPYLAPGLLGNIG
A0A6I9LQL5_BAD-02       --------------PSEQEDSSTADRGLGPSFTGDQRGPYLAPGLLGNIG
A0A8C8TKK3_BBC3-01      XXXXXXXALGGPRWPGGPRSRPRGPRPDGP--------------------
A0A6I9LW27_BCL2L11      --------------PGAPTSLQTEPQ------------------------
A0A6I9LW27_BCL2L11      --------------PGAPTSLQTEPQ------------------------
A0A6I9LW27_BCL2L11      --------------PGAPTSLQTEPQGNPDGGGEGDRCPHGSPQGPLAPP
                                      *                                   

A0A6I9LHF8_BMF-01       LFAQSQLDCPLSRLQLFPLTHCCG----------PGLRPISQEDKATQTL
A0A6I9LKH4_BIK-01       LAYIG-----------------------------DEMDLCLRSPRLAQLP
A0A8C8U1G0_BIK-01       LAYIG-----------------------------DEMDLCLRSPRLAQLP
A0A6J0DIY6_PMAIP1-      ----------------------------------AEMPGRKARKSATRSS
A0A6I9LQL5_BAD-01       HQQGQAANSSHH----------------------GGVGAMETRSRHSSYP
A0A6I9LQL5_BAD-02       HQQGQAANSSHH----------------------GGVGAMETRSRHSSYP
A0A8C8TKK3_BBC3-01      ----------------------------------QPSLSPAQQHLESPVP
A0A6I9LW27_BCL2L11      ----------------------------------DRSPAPMSCDKSTQTP
A0A6I9LW27_BCL2L11      ----------------------------------DRSPAPMSCDKSTQTP
A0A6I9LW27_BCL2L11      ASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTP
                                                                      :   

A0A6I9LHF8_BMF-01       SPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEG
A0A6I9LKH4_BIK-01       GIAMHRLAVTYSQ---------------------------TGVRGVFRSL
A0A8C8U1G0_BIK-01       GIAMHRLAVTYSQ---------------------------TGVRGVFRSL
A0A6J0DIY6_PMAIP1-      SPTPDSEDLEDEC---------------------------V---------
A0A6I9LQL5_BAD-01       AGTEEDEGTEEEL---------------------------SPFRGRSRSA
A0A6I9LQL5_BAD-02       AGTEEDEGTEEEL---------------------------SPFRGRSRSA
A0A8C8TKK3_BBC3-01      SAPEALAGGPTQA---------------------------APGVRGEEEE
A0A6I9LW27_BCL2L11      SPPCQAFNHYLSA---------------------------M-------DL
A0A6I9LW27_BCL2L11      SPPCQAFNHYLSA---------------------------MASIRQSQEE
A0A6I9LW27_BCL2L11      SPPCQAFNHYLSA---------------------------MASIRQSQEE
                        . .                                               

A0A6I9LHF8_BMF-01       QWQHRAEVQIARKLQCIADQFH-----RLHIQQHQQNRDRAWWQVFLFLQ
A0A6I9LKH4_BIK-01       -------------IRGLTNLRENIWSWRVPTPGTWVLPDQARGQLFPMVL
A0A8C8U1G0_BIK-01       -------------IRGLTNLRENIWSWRVPTPGTWVLPDQARGQLFPMVL
A0A6J0DIY6_PMAIP1-      ------------QLRRIGDKLN----------------------------
A0A6I9LQL5_BAD-01       PPNLWAAQRYGRELRRMSDEFEGSFKG----------------EELANSL
A0A6I9LQL5_BAD-02       PPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQSASWTRII
A0A8C8TKK3_BBC3-01      WAR-----EIGAQLRRMADDLNAQYERRRQEEQHRHRPSPWRVMYNLFMG
A0A6I9LW27_BCL2L11      CETLKPREQIHGDAQK----------------------------------
A0A6I9LW27_BCL2L11      PADVRPEIRIAQELRRIGDEFNESYTRR--AEDHPHHPQMVILQLLRFFI
A0A6I9LW27_BCL2L11      PADVRPEIRIAQELRRIGDEFNESYTRR--AEDHPHHPQMVILQLLRFFI
                                      .                                   

A0A6I9LHF8_BMF-01       NLALNREENREGAGPW---
A0A6I9LKH4_BIK-01       LVLLLLGGEALRLQLQ---
A0A8C8U1G0_BIK-01       LVLLLLGGEALRLQLQ---
A0A6J0DIY6_PMAIP1-      --LWQKLLNFISKLFNLVT
A0A6I9LQL5_BAD-01       SPFWCVQ------------
A0A6I9LQL5_BAD-02       QSWWDRNLGKGGSTPSQ--
A0A8C8TKK3_BBC3-01      LLPLPRDPGAPEMEPN---
A0A6I9LW27_BCL2L11      --NW---------------
A0A6I9LW27_BCL2L11      RLVWRRH------------
A0A6I9LW27_BCL2L11      RLVWRRH------------
                                           

© 1998-2023Legal notice