Dataset for protein classical BH3-containing proteins of organism Peromyscus maniculatus bairdii

[Download (right click)] [Alignment] [Repertoires]

10 sequence(s)

>gnl|bcl2dbpro|A0A6I9LHF8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Peromyscus maniculatus bairdii GN=BMF (length=270 residues).
MPGAGVFWKQYRAVRRGLLSRQLAPAAAAALARTTASRRSPLEFAPSFPIECGRQAPRVLVTLDPGAEPWHHDSEAETLS
WSHPGEMEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLS
PASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHIQQHQQ
NRDRAWWQVFLFLQNLALNREENREGAGPW
>gnl|bcl2dbpro|A0A6I9LKH4_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Peromyscus maniculatus bairdii GN=BIK (length=159 residues).
MSEARLMARDLIKTVLHDQVPRPPVAPGAPSMKEPVEEENISPVRDLDLAECLEDRNQVALRLAYIGDEMDLCLRSPRLA
QLPGIAMHRLAVTYSQTGVRGVFRSLIRGLTNLRENIWSWRVPTPGTWVLPDQARGQLFPMVLLVLLLLGGEALRLQLQ
>gnl|bcl2dbpro|A0A6I9LQL5_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Peromyscus maniculatus bairdii GN=BAD (length=178 residues).
MGTPKQPLLAPAHALGVRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDSSTADRGLGPSFTGDQRGPYLAPG
LLGNIGHQQGQAANSSHHGGVGAMETRSRHSSYPAGTEEDEGTEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEG
SFKGEELANSLSPFWCVQ
>gnl|bcl2dbpro|A0A6I9LQL5_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Peromyscus maniculatus bairdii GN=BAD (length=204 residues).
MGTPKQPLLAPAHALGVRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDSSTADRGLGPSFTGDQRGPYLAPG
LLGNIGHQQGQAANSSHHGGVGAMETRSRHSSYPAGTEEDEGTEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEG
SFKGLPRPKSAGTATQMRQSASWTRIIQSWWDRNLGKGGSTPSQ
>gnl|bcl2dbpro|A0A6I9LW27_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Peromyscus maniculatus bairdii GN=BCL2L11 (length=193 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPDGGGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIF
VRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPADVRPEIRIAQELRRIGDEFN
ESYTRRAEDHPHHPQMVILQLLRFFIRLVWRRH
>gnl|bcl2dbpro|A0A6I9LW27_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Peromyscus maniculatus bairdii GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEE
PADVRPEIRIAQELRRIGDEFNESYTRRAEDHPHHPQMVILQLLRFFIRLVWRRH
>gnl|bcl2dbpro|A0A6I9LW27_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Peromyscus maniculatus bairdii GN=BCL2L11 (length=91 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDLCETLKPR
EQIHGDAQKNW
>gnl|bcl2dbpro|A0A6J0DIY6_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Peromyscus maniculatus bairdii GN=PMAIP1 (length=104 residues).
MPRSQARPNAPSNAAWAELAPEFAAQLRRIGDKLYSARCEPDITAVLAEMPGRKARKSATRSSSPTPDSEDLEDECVQLR
RIGDKLNLWQKLLNFISKLFNLVT
>gnl|bcl2dbpro|A0A8C8TKK3_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Peromyscus maniculatus bairdii GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXALGGPRWPGG
PRSRPRGPRPDGPQPSLSPAQQHLESPVPSAPEALAGGPTQAAPGVRGEEEEWAREIGAQLRRMADDLNAQYERRRQEEQ
HRHRPSPWRVMYNLFMGLLPLPRDPGAPEMEPN
>gnl|bcl2dbpro|A0A8C8U1G0_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Peromyscus maniculatus bairdii GN=BIK (length=151 residues).
MSEARLMARDLIKTVLHDQVPRPPVAPGAPSMKEPVRDLDLAECLEDRNQVALRLAYIGDEMDLCLRSPRLAQLPGIAMH
RLAVTYSQTGVRGVFRSLIRGLTNLRENIWSWRVPTPGTWVLPDQARGQLFPMVLLVLLLLGGEALRLQLQ
© 1998-2022Legal notice