Dataset for protein Bad of organism Peromyscus maniculatus bairdii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MGTPKQPLLAPAHALGVRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDSSTADRGLGPSFTGDQRGPYLAPG
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
LLGNIGHQQGQAANSSHHGGVGAMETRSRHSSYPAGTEEDEGTEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEG
                                                                                

       170       180       190       200    
....:....|....:....|....:....|....:....|....
****                 . :. :..:*  :          
SFKG----------------eswtrslsswWdvq----------
    lprpksagtatqmrqsaelaniiqpf crnlgkggstpsq
© 1998-2022Legal notice