Dataset for protein Bad of organism Peromyscus maniculatus bairdii

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A6I9LQL5_BAD-01      MGTPKQPLLAPAHALGVRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFE
A0A6I9LQL5_BAD-02      MGTPKQPLLAPAHALGVRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFE
                       **************************************************

A0A6I9LQL5_BAD-01      PSEQEDSSTADRGLGPSFTGDQRGPYLAPGLLGNIGHQQGQAANSSHHGG
A0A6I9LQL5_BAD-02      PSEQEDSSTADRGLGPSFTGDQRGPYLAPGLLGNIGHQQGQAANSSHHGG
                       **************************************************

A0A6I9LQL5_BAD-01      VGAMETRSRHSSYPAGTEEDEGTEEELSPFRGRSRSAPPNLWAAQRYGRE
A0A6I9LQL5_BAD-02      VGAMETRSRHSSYPAGTEEDEGTEEELSPFRGRSRSAPPNLWAAQRYGRE
                       **************************************************

A0A6I9LQL5_BAD-01      LRRMSDEFEGSFKG----------------EELANSLSPFWCVQ------
A0A6I9LQL5_BAD-02      LRRMSDEFEGSFKGLPRPKSAGTATQMRQSASWTRIIQSWWDRNLGKGGS
                       **************                 . :. :..:*  :      

A0A6I9LQL5_BAD-01      ----
A0A6I9LQL5_BAD-02      TPSQ
                           

© 1998-2022Legal notice