Dataset for protein Bad of organism Peromyscus maniculatus bairdii

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A6I9LQL5_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Peromyscus maniculatus bairdii GN=BAD (length=178 residues).
MGTPKQPLLAPAHALGVRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDSSTADRGLGPSFTGDQRGPYLAPG
LLGNIGHQQGQAANSSHHGGVGAMETRSRHSSYPAGTEEDEGTEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEG
SFKGEELANSLSPFWCVQ
>gnl|bcl2dbpro|A0A6I9LQL5_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Peromyscus maniculatus bairdii GN=BAD (length=204 residues).
MGTPKQPLLAPAHALGVRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDSSTADRGLGPSFTGDQRGPYLAPG
LLGNIGHQQGQAANSSHHGGVGAMETRSRHSSYPAGTEEDEGTEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEG
SFKGLPRPKSAGTATQMRQSASWTRIIQSWWDRNLGKGGSTPSQ
© 1998-2022Legal notice