Dataset for protein classical BH3-containing proteins of organism Pavo cristatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--mp--------pp-a-apr-rr-gt---g--p-----------------------------------------------
hr--kntirktq--r-p---s--k--lpp-ln-gpavpprpgspsarpsrpspqpfpgrplarggrcrsapplligcrag
  sagk    ppt eskrgke  aeraallegf   a lea a a llg                               
          ka  a e   d         aa                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
agparrgwgcrqlfavrsaaaavwrwggavtvpalgappslwdarpgparpgplggamdrpsyleedysgldgldddvfh
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       .                                                                        
------ag-p---g--g-f----s-fff--rf-l-p-s----pg-------r---p--cdkatq----------------
sddfgl-ar-vst-st-p-tqrs-y---vr--q-s-r-hccs--yfslvri-sps-ms------tpspssssvsvylscm
        qegeptkphi sinqplscltgfsp l lt   ls v dfeaek  h eqqfaerd l  pcqaqdhm pag
        g adm ak a afcf f   l   f f i    g  k         a ca                      

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                          .    * :*: *.*: .                     
-------------gy-----------------epqegqqeartevqiArkLrrIgDqfhrlhiqr---------------
vteeprrlfygna--rlhvppvgfaldpnlqe----------pvtwc qe qc a kanl-----vvqfqrxqvwwqlfl
as           rw                 rshslae iqa ie  l       e dasycp rqc n n     i  
                                                                 hg             

       330       340       350       360       370       380       390     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
           . :                                                             
-----------nrev--------------------------------------------------------t--t
fllslslrvtsrqnrlnliwklalwqvfcslkcrkgcaggcrllpprhsihsaspfelgpeifgcrgfihg-qsr
  hnia nteekdkq  h t           f                                       pgqq
        iaa   k                                                         eaf
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice