Dataset for protein classical BH3-containing proteins of organism Pavo cristatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------gpgpa-p--pgapaar--r--p---pg-p----g--a---pl-ff-r----l-
mhrsppntptprsrrpksrrgtlppmp-----v-pr-------ps-ps-qsn--s-vdtg-rh-sss--s--v-tspl-s
 akq keaka  de a     raalleaktirk lpaas sgllrakrtgpff relar kpfrirpcfligffrgfgpp
                         ga     a ae       eg ae al   g      kc faf  f  c afaf a

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
r-s-g---l-a-rspap--c------------------------------------------------------------
-s-w-yrs-v-v-----mv-rwgtqvtvpplqavssywsarpsrwrshslggamdrpsyleedysgldgldddvfhsddf
prgspgkqffrik asacswfkagatps acg pphlld magpa pgp a                             
 i l cfd e e     aa d                                                           

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
glagqpgemtatgiftqnqsyscllgrfqlfplthccgpgvrhpeqqdkatqtlspssssqdvmlpcgvteeprrlfygn
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                           *  .    * :*. *.*:          :   .  .                 
--------------------------qEartevqiArkLrrIgDq----------fhrlhiqrv----------------
agyrlhvppvgfaldpnlqeepqegqe rqpvtwc qe qc a kadlrqkvlnlitksycrktqqnrrxvwwvlflfll
                          a ida ie  l       e           na f p rgcfqnq   qi    h
                                                               h                

       330       340       350       360       370       380       390  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
                                                                        
--------nre-------------------------------------------------------------
slslrvts---rtqqrwklalwqvfcslkcrkgcaggcrllpprhsihsaspfelgpeifgcrgfihgtesq
nia qteekdnqpnhi                                                        
    niaa   klgaf                                                        
© 1998-2022Legal notice