Dataset for protein classical BH3-containing proteins of organism Pavo cristatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C9F456_PMAIP1-      -------------------------MPGKTIRKPAPPAAPAGRERRKETG
A0A8C9F3R5_BMF-02       --------------------------------------------------
A0A8C9EIW6_BCL2L11      MAKQPPEAKAPRDRRA----GRLPPGEGPGPAVPLRPGAPAALPGAARPA
A0A8C9F3R5_BMF-01       -HRSPKNTPTPRSERPKSRRGTAALLAAPGPAAPPEAGSPSARLSRPSPQ
                                                                          

A0A8C9F456_PMAIP1-      LNFGGEVDTGKKHAFSFCFSFFFFTFFFLSPISLPGKDLVRIKSPSPCAC
A0A8C9F3R5_BMF-02       --------------------------------------------------
A0A8C9EIW6_BCL2L11      S-PGSP----GPFAIRSPLFFFVRRSPLLPRSSSGYFSFEAERSPAPMSC
A0A8C9F3R5_BMF-01       PFPGRPLARGGRCRSAPPLLIGCRAGAGPARRGWGCRQLFAVRSAAAAVW
                                                                          

A0A8C9F456_PMAIP1-      F-------------------------------------------------
A0A8C9F3R5_BMF-02       ---------------------------------MDRPSYLEEDYSGLDGL
A0A8C9EIW6_BCL2L11      DKATQTPSPPCQAVSHYLSAMASRWRSHSLA-------------------
A0A8C9F3R5_BMF-01       RWGGAVTVPALGAPPSLWDARPGPARPGPLGGAMDRPSYLEEDYSGLDGL
                                                                          

A0A8C9F456_PMAIP1-      --------------------------------------------------
A0A8C9F3R5_BMF-02       DDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPG
A0A8C9EIW6_BCL2L11      --------------------------------------------------
A0A8C9F3R5_BMF-01       DDDVFHSDDFGLA-------------------------------------
                                                                          

A0A8C9F456_PMAIP1-      --------------------------------------------------
A0A8C9F3R5_BMF-02       VRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPV
A0A8C9EIW6_BCL2L11      --------------------------------------------------
A0A8C9F3R5_BMF-01       --------------------------------------GNAGYRLHVPPV
                                                                          

A0A8C9F456_PMAIP1-      ----------------AERDAVTECALELRRIGDKADLRQKVLNLITKLF
A0A8C9F3R5_BMF-02       GFALDPNLQEEPQEGQQEARTEVQIARKLQCIADQ----------FHRLH
A0A8C9EIW6_BCL2L11      ----------------EEIQPEIWIAQELRRIGDE----------FNASY
A0A8C9F3R5_BMF-01       GFALDPNLQEEPQEGQQEARTEVQIARKLQCIADQ----------FHRLH
                                         *  .    * :*. *.*:          :   .

A0A8C9F456_PMAIP1-      CRKT----------------------------------------------
A0A8C9F3R5_BMF-02       IQRVGCFQRX--------------QITENDEQPQAF--------------
A0A8C9EIW6_BCL2L11      CPRR---------VIFLFLLSISLRTASKREKLNHIWKLALWQVFCSLKC
A0A8C9F3R5_BMF-01       IQRHQQNRNQVWWQLFLFLHNLALNVEANRNRTGQR--------------
                          .                                               

A0A8C9F456_PMAIP1-      ------------------------------------------
A0A8C9F3R5_BMF-02       ------------------------------------------
A0A8C9EIW6_BCL2L11      RKGCAGGCRLLPPRHSIHSASPFELGPEIFGCRGFIHGTESQ
A0A8C9F3R5_BMF-01       ------------------------------------------
                                                                  

© 1998-2022Legal notice