Dataset for protein classical BH3-containing proteins of organism Pavo cristatus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C9EIW6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Pavo cristatus GN=BCL2L11 (length=229 residues).
MAKQPPEAKAPRDRRAGRLPPGEGPGPAVPLRPGAPAALPGAARPASPGSPGPFAIRSPLFFFVRRSPLLPRSSSGYFSF
EAERSPAPMSCDKATQTPSPPCQAVSHYLSAMASRWRSHSLAEEIQPEIWIAQELRRIGDEFNASYCPRRVIFLFLLSIS
LRTASKREKLNHIWKLALWQVFCSLKCRKGCAGGCRLLPPRHSIHSASPFELGPEIFGCRGFIHGTESQ
>gnl|bcl2dbpro|A0A8C9F3R5_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Pavo cristatus GN=BMF (length=250 residues).
HRSPKNTPTPRSERPKSRRGTAALLAAPGPAAPPEAGSPSARLSRPSPQPFPGRPLARGGRCRSAPPLLIGCRAGAGPAR
RGWGCRQLFAVRSAAAAVWRWGGAVTVPALGAPPSLWDARPGPARPGPLGGAMDRPSYLEEDYSGLDGLDDDVFHSDDFG
LAGNAGYRLHVPPVGFALDPNLQEEPQEGQQEARTEVQIARKLQCIADQFHRLHIQRHQQNRNQVWWQLFLFLHNLALNV
EANRNRTGQR
>gnl|bcl2dbpro|A0A8C9F3R5_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Pavo cristatus GN=BMF (length=179 residues).
MDRPSYLEEDYSGLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQQEARTEVQIARKLQCIADQFHRLHIQR
VGCFQRXQITENDEQPQAF
>gnl|bcl2dbpro|A0A8C9F456_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Pavo cristatus GN=PMAIP1 (length=114 residues).
MPGKTIRKPAPPAAPAGRERRKETGLNFGGEVDTGKKHAFSFCFSFFFFTFFFLSPISLPGKDLVRIKSPSPCACFAERD
AVTECALELRRIGDKADLRQKVLNLITKLFCRKT
© 1998-2022Legal notice