Dataset for protein Bmf of organism Pavo cristatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
hrspkntptprserpksrrgtaallaapgpaappeagspsarlsrpspqpfpgrplarggrcrsapplligcragagpar

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                    ****************************
----------------------------------------------------MDRPSYLEEDYSGLDGLDDDVFHSDDFG
rgwgcrqlfavrsaaaavwrwggavtvpalgappslwdarpgparpgplgga                            

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**                                                                           ***
LA---------------------------------------------------------------------------GNA
  gqpgemtatgiftqnqsyscllgrfqlfplthccgpgvrhpeqqdkatqtlspssssqdvmlpcgvteeprrlfy   

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****************************************************    ..               ::  * :
GYRLHVPPVGFALDPNLQEEPQEGQQEARTEVQIARKLQCIADQFHRLHIQRvqqnrrx--------------qvteNrn
                                                    hgcfqnqvwwqlflflhnlalniea de

     
....:
..   
rtqqr
qpgaf
© 1998-2022Legal notice