Dataset for protein Bmf of organism Pavo cristatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C9F3R5_BMF-01      HRSPKNTPTPRSERPKSRRGTAALLAAPGPAAPPEAGSPSARLSRPSPQP
A0A8C9F3R5_BMF-02      --------------------------------------------------
                                                                         

A0A8C9F3R5_BMF-01      FPGRPLARGGRCRSAPPLLIGCRAGAGPARRGWGCRQLFAVRSAAAAVWR
A0A8C9F3R5_BMF-02      --------------------------------------------------
                                                                         

A0A8C9F3R5_BMF-01      WGGAVTVPALGAPPSLWDARPGPARPGPLGGAMDRPSYLEEDYSGLDGLD
A0A8C9F3R5_BMF-02      --------------------------------MDRPSYLEEDYSGLDGLD
                                                       ******************

A0A8C9F3R5_BMF-01      DDVFHSDDFGLA--------------------------------------
A0A8C9F3R5_BMF-02      DDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGV
                       ************                                      

A0A8C9F3R5_BMF-01      -------------------------------------GNAGYRLHVPPVG
A0A8C9F3R5_BMF-02      RHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVG
                                                            *************

A0A8C9F3R5_BMF-01      FALDPNLQEEPQEGQQEARTEVQIARKLQCIADQFHRLHIQRHQQNRNQV
A0A8C9F3R5_BMF-02      FALDPNLQEEPQEGQQEARTEVQIARKLQCIADQFHRLHIQRVGCFQRX-
                       ******************************************    ..  

A0A8C9F3R5_BMF-01      WWQLFLFLHNLALNVEANRNRTGQR
A0A8C9F3R5_BMF-02      -------------QITENDEQPQAF
                                    ::  * :..   

© 1998-2022Legal notice