Dataset for protein Bmf of organism Pavo cristatus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C9F3R5_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Pavo cristatus GN=BMF (length=250 residues).
HRSPKNTPTPRSERPKSRRGTAALLAAPGPAAPPEAGSPSARLSRPSPQPFPGRPLARGGRCRSAPPLLIGCRAGAGPAR
RGWGCRQLFAVRSAAAAVWRWGGAVTVPALGAPPSLWDARPGPARPGPLGGAMDRPSYLEEDYSGLDGLDDDVFHSDDFG
LAGNAGYRLHVPPVGFALDPNLQEEPQEGQQEARTEVQIARKLQCIADQFHRLHIQRHQQNRNQVWWQLFLFLHNLALNV
EANRNRTGQR
>gnl|bcl2dbpro|A0A8C9F3R5_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Pavo cristatus GN=BMF (length=179 residues).
MDRPSYLEEDYSGLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQQEARTEVQIARKLQCIADQFHRLHIQR
VGCFQRXQITENDEQPQAF
© 1998-2022Legal notice