Dataset for protein classical BH3-containing proteins of organism Panthera tigris altaica

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------makqpsdvssecdreggqlqpaerp--pqlrpgaptslqte---qqg-p---------------------p-g-
mfqipe---------------------g---rg-g--------anlfaqs---n-egegdrggagavetrsrhssc-q-s
      femeepqcvepleddvfpped-d     -tqqrsllg---x gh ldc lshlql              f lth
        ps qed   t  gl  spt        kh  tap xxxw      q a snhh              y a t
                                            lg                                  
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--gp---p-sp-pfatrs--------------------------------papmscdkstqtp----sppcqafn-----
pq--lap-a--g------psappnlfifvrrssllsrsssgyfsfdtdrs-------------cgvt--------gnagy
ccdeglreteqedkrgqtl      waal ygre r m defqgsfkkgl s a psqgvmlr    ee qrlwy     
ee   te e  s      r                                r k agta  m     qs   s t     
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------hylsamasmrqpqavpadmrpeiwiaqelrrigdefn-------------------------------------
rlplpa----x-------g-l----------------------ayyprrlmnnnyqlfrsqtqmiilrllryivrliwrl
      sfpqsxxxxxxx-x-xxqxxf vecerqwgcfqsklsrlfrqkvflliskaaeagplflhnla naeenrngag
      rpikqsvrvvtvxvxhwxvpa crwdmn q sa qphq hm qhqrvrrsywwqil                  
      a aapqslikeespsetrpg   qr  k   g  a         aq parvi                      
          gpp giadpmg g h                                                       
          cll ae  klf                                                           
                   e                                                            

  
..
  
--
qr
pq

  
  
  
  
© 1998-2023Legal notice