Dataset for protein classical BH3-containing proteins of organism Panthera tigris altaica

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------makqpsdvssecdreggqlqpaerppqlrpgaptslqteqq---------------------------
mfqipefepseq----------------d----------t----l--anlfaxgnpegegdrcpqgspqgplappaspgp
            edssmeppqcveeltd-vfrgedgeqg-q  s-le---xxs                           
                 t rglgpsp   rp  pgkh r a  l g xxxwcg                           
                                                ghq                             
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------s-ls----g------drspapmscdkstqtpsppcqafnhylsamasmrqpqav------------
fatrsplfifvrrs-l--rsss-yfsfdt----------------------------------e-grlfygpagyrlppp
          sqldcpnhhlqlfplthccgpglr tgqedkatqtlseaspsqgvmlpcgvte-xxxx  an     kl 
            pa s   gga avetrsrh sy a t edeg eee p   r      xxxxxvrvs            
                                                           vriktsksf            
                                                           l aire ma            
                                                                  l             

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------padmrpeiwiaqelrrigdefn--ypr---------------------l--------r------
ssvvagsplptqppeg-------ve--r----------ay---rvflnryqaaeaqpqmiilrl-rylisslw-lqrgrg
a fp dl  ge     xxxxxaa--cg-qqqcfs klqrsfrqkhqqpnrrvwwtitlfrqspswmrivrlifdsgt   
                hwrvwr qry ms   ma q hglhmkq     pks gqal  lhnla tnvpqkyiarpq   
                gpqlp  lqw  k            k g                     nafenrwg gnl   
                egnh                                             a e a n   e    
                 fec                                                            

      
....:.
      
------
gsapsq
      
      
      
      
      
© 1998-2022Legal notice