Dataset for protein classical BH3-containing proteins of organism Panthera tigris altaica

[Download (right click)] [Alignment] [Repertoires]

11 sequence(s)

>gnl|bcl2dbpro|A0A8C9IYS3_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Panthera tigris altaica GN=BMF (length=130 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAKPPSSVVADSPLPTQPGFECRREQEWGRSQ
>gnl|bcl2dbpro|A0A8C9IYS3_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Panthera tigris altaica GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGHWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRRRVW
WQILLFLHNLALNAEENRNGAGPR
>gnl|bcl2dbpro|A0A8C9J1B3_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Panthera tigris altaica GN=PMAIP1 (length=54 residues).
XXXXXXXXXXXXXXXXXXXXPEVECAMQLRRFGDKLNFRQKLMNLISKLFRSGT
>gnl|bcl2dbpro|A0A8C9J1B3_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Panthera tigris altaica GN=PMAIP1 (length=51 residues).
WCSLSIKTVKMSPGRVPPEVECAMQLRRFGDKLNFRQKLMNLISKLFRSGT
>gnl|bcl2dbpro|A0A8C9J6L6_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Panthera tigris altaica GN=BAD (length=169 residues).
MFQIPEFEPSEQEDSSPTDRGLGPSPTGDRPRGPGKHQRTAPGLLGEAGHQQGQPASSNHHGGAGAVETRSRHSSYPAGT
EEDEGTEEEEPSPFRGRSRSAPPNLWAALRYGRELRRMSDEFQGSFKKGLPRPKSAGTATQMRQSPSWTRFIQSWWDRNL
GRGGSAPSQ
>gnl|bcl2dbpro|A0A8C9JC73_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Panthera tigris altaica GN=BCL2L11 (length=131 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGLFE
>gnl|bcl2dbpro|A0A8C9JC73_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Panthera tigris altaica GN=BCL2L11 (length=136 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVRAIEEGVL
>gnl|bcl2dbpro|A0A8C9JC73_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Panthera tigris altaica GN=BCL2L11 (length=167 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRLEQ
>gnl|bcl2dbpro|A0A8C9JC73_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Panthera tigris altaica GN=BCL2L11 (length=197 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRVFLNNYQAAEAQPQMIILRLLRYIVRLIWRLQR
>gnl|bcl2dbpro|A0A8C9JC73_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Panthera tigris altaica GN=BCL2L11 (length=87 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQASMRQPQAVPADMRPEIWIAQELRRIGDEFNAYYPRRLA
RVPASYI
>gnl|bcl2dbpro|A0A8C9JC73_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Panthera tigris altaica GN=BCL2L11 (length=141 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAV
PADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAQPQMIILRLLRYIVRLIWRLQR
© 1998-2022Legal notice