Dataset for protein classical BH3-containing proteins of organism Panthera tigris altaica

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C9JC73_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERP--PQLRPGAPTSLQTE---
A0A8C9J1B3_PMAIP1-      ----------------------------------------------W---
A0A8C9J1B3_PMAIP1-      -------------------------------------------XXXX---
A0A8C9IYS3_BMF-01       --------MEPPQCVEELEDDVFQPEDGE----PGTQPGSLLSANLFAQS
A0A8C9IYS3_BMF-02       --------MEPPQCVEELEDDVFQPEDGE----PGTQPGSLLSANLFAQS
A0A8C9J6L6_BAD-01       MFQIPEFEPSEQEDSSPTDRGLGPSPTGDRPRGPGKHQRTAPGLLGEAGH
A0A8C9JC73_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERP--PQLRPGAPTSLQTE---
A0A8C9JC73_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERP--PQLRPGAPTSLQTE---
A0A8C9JC73_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERP--PQLRPGAPTSLQTE---
A0A8C9JC73_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERP--PQLRPGAPTSLQTE---
A0A8C9JC73_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERP--PQLRPGAPTSLQTE---
                                                                          

A0A8C9JC73_BCL2L11      --------------------------------------------------
A0A8C9J1B3_PMAIP1-      --------------------------------------------------
A0A8C9J1B3_PMAIP1-      --------------------------------------------------
A0A8C9IYS3_BMF-01       QLDCPLSHLQL--------------FPLTHCCGPGLRPTSQEDKATQTL-
A0A8C9IYS3_BMF-02       QLDCPLSHLQL--------------FPLTHCCGPGLRPTSQEDKATQTL-
A0A8C9J6L6_BAD-01       QQGQPASSNHHGGAGAVETRSRHSSYPAGTEEDEGTEEEEPSPFRGRSRS
A0A8C9JC73_BCL2L11      QQ------------------------------------------------
A0A8C9JC73_BCL2L11      QQGNPEGEGDR--------------CPQGSPQGPLAPPASPGPFATRSP-
A0A8C9JC73_BCL2L11      QQGNPEGEGDR--------------CPQGSPQGPLAPPASPGPFATRSP-
A0A8C9JC73_BCL2L11      QQGNPEGEGDR--------------CPQGSPQGPLAPPASPGPFATRSP-
A0A8C9JC73_BCL2L11      QQGNPEGEGDR--------------CPQGSPQGPLAPPASPGPFATRSP-
                                                                          

A0A8C9JC73_BCL2L11      --------------------------------------------------
A0A8C9J1B3_PMAIP1-      --------------------------------------------------
A0A8C9J1B3_PMAIP1-      --------------------------------------------------
A0A8C9IYS3_BMF-01       -------------------------------SPASPSQGVMLPCGVTEEP
A0A8C9IYS3_BMF-02       -------------------------------SPASPSQGVMLPCGVTEEP
A0A8C9J6L6_BAD-01       APPNLWAALRYGRELRRMSDEFQGSFKKGLPRPKSAGTATQMR----QSP
A0A8C9JC73_BCL2L11      ---------------------------DRSPAPMSCDKSTQTP----SPP
A0A8C9JC73_BCL2L11      ----LFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTP----SPP
A0A8C9JC73_BCL2L11      ----LFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTP----SPP
A0A8C9JC73_BCL2L11      ----LFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTP----SPP
A0A8C9JC73_BCL2L11      ----LFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTP----SPP
                                                                          

A0A8C9JC73_BCL2L11      --------------------QQASMRQPQAVPADMRPEIWIAQELRRIGD
A0A8C9J1B3_PMAIP1-      --------------------CSLSIKTVKMSPGRVPPEVECAMQLRRFGD
A0A8C9J1B3_PMAIP1-      --------------------XXXXXXXXXXXXXXXXPEVECAMQLRRFGD
A0A8C9IYS3_BMF-01       QRLFYGNAGYRLPLPASFPAGLPLGEQPPEGHWQHRAEVQIARKLQCIAD
A0A8C9IYS3_BMF-02       QRLFY-----------APAKPPSSVVADSPLPTQPGFECRREQEWGRSQ-
A0A8C9J6L6_BAD-01       --SWT-----------RFIQS------------------WWDRNLGRGGS
A0A8C9JC73_BCL2L11      CQAFN-----------HYLSAMASMRQPQAVPADMRPEIWIAQELRRIGD
A0A8C9JC73_BCL2L11      CQAFN-----------HYLSAM------GLFE------------------
A0A8C9JC73_BCL2L11      CQAFN-----------HYLSAMVRAIEEGVL-------------------
A0A8C9JC73_BCL2L11      CQAFN-----------HYLSAMASMRQPQAVPADMRPEIWIAQELRRIGD
A0A8C9JC73_BCL2L11      CQAFN-----------HYLSAMASMRQPQAVPADMRPEIWIAQELRRIGD
                                                                          

A0A8C9JC73_BCL2L11      EFNAYYPRRLARVPASYI------------------------
A0A8C9J1B3_PMAIP1-      KLN--FRQKLMNLISKLFRSGT--------------------
A0A8C9J1B3_PMAIP1-      KLN--FRQKLMNLISKLFRSGT--------------------
A0A8C9IYS3_BMF-01       QFHRLHMQQHQQNRRRVWWQILLFLHNLALNAEENRNGAGPR
A0A8C9IYS3_BMF-02       ------------------------------------------
A0A8C9J6L6_BAD-01       APSQ--------------------------------------
A0A8C9JC73_BCL2L11      EFNAYYPRRVFLNNYQAAEAQPQMIILRLLRYIVRLIWRLQR
A0A8C9JC73_BCL2L11      ------------------------------------------
A0A8C9JC73_BCL2L11      ------------------------------------------
A0A8C9JC73_BCL2L11      EFNAYYPR------------------------------RLEQ
A0A8C9JC73_BCL2L11      EFNAYYPRRVFLNNYQAAEAQPQMIILRLLRYIVRLIWRLQR
                                                                  

© 1998-2023Legal notice