Dataset for protein classical BH3-containing proteins of organism Panthera tigris altaica

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C9IYS3_BMF-02       ----------------MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSANL
A0A8C9IYS3_BMF-01       ----------------MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSANL
A0A8C9J6L6_BAD-01       MFQIPEFEPSEQEDSSPTDRGLGPSPTGDRPRGPGKHQRTAPGLLGEAGH
A0A8C9JC73_BCL2L11      ------------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQT
A0A8C9JC73_BCL2L11      ------------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQT
A0A8C9JC73_BCL2L11      ------------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQT
A0A8C9JC73_BCL2L11      ------------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQT
A0A8C9JC73_BCL2L11      ------------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQT
A0A8C9JC73_BCL2L11      ------------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQT
A0A8C9J1B3_PMAIP1-      -----------------------------------------------XXX
A0A8C9J1B3_PMAIP1-      --------------------------------------------------
                                                                          

A0A8C9IYS3_BMF-02       FAQ-------------------------------------SQLDCPLSHL
A0A8C9IYS3_BMF-01       FAQ-------------------------------------SQLDCPLSHL
A0A8C9J6L6_BAD-01       QQG--------------------------------------QPASSNHHG
A0A8C9JC73_BCL2L11      EQQ-----------------------------------------------
A0A8C9JC73_BCL2L11      EQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRS
A0A8C9JC73_BCL2L11      EQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRS
A0A8C9JC73_BCL2L11      EQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRS
A0A8C9JC73_BCL2L11      EQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRS
A0A8C9JC73_BCL2L11      EQQ-----------------------------------------------
A0A8C9J1B3_PMAIP1-      XXX-----------------------------------------------
A0A8C9J1B3_PMAIP1-      WCS-----------------------------------------------
                                                                          

A0A8C9IYS3_BMF-02       QLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFY
A0A8C9IYS3_BMF-01       QLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFY
A0A8C9J6L6_BAD-01       GAGAVETRSRHSSYPAGTEEDEGTEEEEPSPFRG---------RSRSA--
A0A8C9JC73_BCL2L11      ---------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAV--
A0A8C9JC73_BCL2L11      SSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM------GLF--
A0A8C9JC73_BCL2L11      SSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVRAIEEGVL--
A0A8C9JC73_BCL2L11      SSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAV--
A0A8C9JC73_BCL2L11      SSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAV--
A0A8C9JC73_BCL2L11      ---------------------------------------ASMRQPQAV--
A0A8C9J1B3_PMAIP1-      ---------------------------------------XXXXXXXXX--
A0A8C9J1B3_PMAIP1-      ---------------------------------------LSIKTVKMS--
                                                                          

A0A8C9IYS3_BMF-02       APA----KPPSSVVADSPLPTQP---GFECRREQEWGRSQ----------
A0A8C9IYS3_BMF-01       GNAGYRLPLPASFPAGLPLGEQPPEGHWQHRAEVQIARKLQCIADQFHRL
A0A8C9J6L6_BAD-01       --------------------------PPNLWAALRYGRELRRMSDEFQGS
A0A8C9JC73_BCL2L11      --------------------------PADMRPEIWIAQELRRIGDEFNAY
A0A8C9JC73_BCL2L11      --------------------------E-----------------------
A0A8C9JC73_BCL2L11      --------------------------------------------------
A0A8C9JC73_BCL2L11      --------------------------PADMRPEIWIAQELRRIGDEFNAY
A0A8C9JC73_BCL2L11      --------------------------PADMRPEIWIAQELRRIGDEFNAY
A0A8C9JC73_BCL2L11      --------------------------PADMRPEIWIAQELRRIGDEFNAY
A0A8C9J1B3_PMAIP1-      --------------------------XXXXXPEVECAMQLRRFGDKLN--
A0A8C9J1B3_PMAIP1-      --------------------------PGRVPPEVECAMQLRRFGDKLN--
                                                                          

A0A8C9IYS3_BMF-02       ----------------------------------------------
A0A8C9IYS3_BMF-01       HMQQHQQNRRRVWWQILLFLHNLALNAEENRNGAGPR---------
A0A8C9J6L6_BAD-01       FKKG--LPRPKSAGTATQMRQSPSWTRFIQSWWDRNLGRGGSAPSQ
A0A8C9JC73_BCL2L11      YPRRVFLNNYQAAEAQPQMIILRLLRYIVRLIWRLQR---------
A0A8C9JC73_BCL2L11      ----------------------------------------------
A0A8C9JC73_BCL2L11      ----------------------------------------------
A0A8C9JC73_BCL2L11      YPR------------------------------RLEQ---------
A0A8C9JC73_BCL2L11      YPRRVFLNNYQAAEAQPQMIILRLLRYIVRLIWRLQR---------
A0A8C9JC73_BCL2L11      YPRR--------------------LARVPASYI-------------
A0A8C9J1B3_PMAIP1-      FRQK--------------------LMNLISKLFRSGT---------
A0A8C9J1B3_PMAIP1-      FRQK--------------------LMNLISKLFRSGT---------
                                                                      

© 1998-2022Legal notice