Dataset for protein Bim of organism Panthera tigris altaica

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************************************                                       
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQgnpegegdrcpqgspqgplappaspgpfatrsplfifvr
                                         ---------------------------------------
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                       .                        
rssllsrsssgyfsfdtdrspapmscdkstqtpsppcqafnhylsamasmrqpqavpadmrpeiwiaqelrrigdefnay
-----------------------------------------------------gvl------------------------
                                               vraiee lfe                       

       170       180       190       
....:....|....:....|....:....|....:..
                                     
ypr----------------------------------
---rvflnnyqaaeaqpqmiilrllryivrliwrlqr
    larvpasyi                      eq
© 1998-2022Legal notice