Dataset for protein Bim of organism Panthera tigris altaica

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C9JC73_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQ---------
A0A8C9JC73_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQ---------
A0A8C9JC73_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDR
A0A8C9JC73_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDR
A0A8C9JC73_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDR
A0A8C9JC73_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDR
                        *****************************************         

A0A8C9JC73_BCL2L11      --------------------------------------------------
A0A8C9JC73_BCL2L11      -----------------------------------------------DRS
A0A8C9JC73_BCL2L11      CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
A0A8C9JC73_BCL2L11      CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
A0A8C9JC73_BCL2L11      CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
A0A8C9JC73_BCL2L11      CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
                                                                          

A0A8C9JC73_BCL2L11      ---------------------------ASMRQPQAVPADMRPEIWIAQEL
A0A8C9JC73_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAVPADMRPEIWIAQEL
A0A8C9JC73_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAM------GLFE-------------
A0A8C9JC73_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMVRAIEEGVL--------------
A0A8C9JC73_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAVPADMRPEIWIAQEL
A0A8C9JC73_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAVPADMRPEIWIAQEL
                                                           .              

A0A8C9JC73_BCL2L11      RRIGDEFNAYYPRRLARVPASYI------------------------
A0A8C9JC73_BCL2L11      RRIGDEFNAYYPRRVFLNNYQAAEAQPQMIILRLLRYIVRLIWRLQR
A0A8C9JC73_BCL2L11      -----------------------------------------------
A0A8C9JC73_BCL2L11      -----------------------------------------------
A0A8C9JC73_BCL2L11      RRIGDEFNAYYPR------------------------------RLEQ
A0A8C9JC73_BCL2L11      RRIGDEFNAYYPRRVFLNNYQAAEAQPQMIILRLLRYIVRLIWRLQR
                                                                       

© 1998-2022Legal notice