Dataset for protein Bim of organism Panthera tigris altaica

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A8C9JC73_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Panthera tigris altaica GN=BCL2L11 (length=131 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGLFE
>gnl|bcl2dbpro|A0A8C9JC73_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Panthera tigris altaica GN=BCL2L11 (length=136 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVRAIEEGVL
>gnl|bcl2dbpro|A0A8C9JC73_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Panthera tigris altaica GN=BCL2L11 (length=167 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRLEQ
>gnl|bcl2dbpro|A0A8C9JC73_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Panthera tigris altaica GN=BCL2L11 (length=197 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRVFLNNYQAAEAQPQMIILRLLRYIVRLIWRLQR
>gnl|bcl2dbpro|A0A8C9JC73_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Panthera tigris altaica GN=BCL2L11 (length=87 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQASMRQPQAVPADMRPEIWIAQELRRIGDEFNAYYPRRLA
RVPASYI
>gnl|bcl2dbpro|A0A8C9JC73_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Panthera tigris altaica GN=BCL2L11 (length=141 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAV
PADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAQPQMIILRLLRYIVRLIWRLQR
© 1998-2022Legal notice