Dataset for protein classical BH3-containing proteins of organism Panthera leo

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mtrtspgqkkrprwewlwegpgrrcgaslsseaghiwggchpqwyfitrsfvisigphfpqvegkgerkggvlqvrpwgr
                                                                               m
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                              .                                                 
------ma--p--vssecdreggllqpaerppqlrpgaptslqte-----------------------------p-----
gqhprh--kq-sd----pqcveeqsrdvfqsepgeaptq------qqgnpegegdrcprrgrrlgrkrprplas-sglps
cpc lcrhrtrqggmep-e--nsredntsvatdatslvesavsvpgpttlvvyygqv                 eqsssq
      lgcg pee gtm-psap tglsps st srhrlqvegrk mrdkaegwepg                  gpnln
         a aa     smp k aakrhl gf qeag pr ed           l                   pdi k
                  aha      ga  f  m    ke dc                                   a
                               a       e  a                                     

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------p------------r-p-p----------------m-----t--p--------
aplapqsspgppltrsqlfpfvrrsslg-gsspgsqsfktd-t-a-efepseqedaspsqgv-spdks-qt-sppcqafn
gnwfapaqldcfashlpvriqylthcclsrlrstyfeddatqslsr         sg tpslslccgvlee qrlgpvqr
sdddvavtvavyqdtrtgpwmmwkvlg   wpmydrawtysmgqr          d  qdrglpasqtgds vgsakhl 
  a gsmr pfigcepeal a taege   qggr lprsrp fgl                  g eph  r r   gg  
      ll  aa aama     p aaa   ma      aqn   i                                   
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----amasmrqpqavpa-------------------------------------------dmrpeiW-------iarelr
hylsllgnag-------ssnhhggagavetrsrhssfpaglplgegteeeepspfrgrsr--pegh-qhraevq-gqq-q
tlvgfy----yrlplgv                   y   teed                qp----     arry--kr-
sapd-- glptqigq                                             sgqrtq      lerrm- s
    qq eg hna p                                             rae rm        c aa  
    gh    e                                                     nl              
                                                                                

       330       340       350       360       370       380      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
                                                                  
rig---defnayyprr------------q------r------l--l------l-r-----------
cmapap-qlh------vfrvsasylnnm-qsqqnr-mirlww-rl-vlliwr-q-eenrngagprq
---   g---gswtwlpapkqvgtrlhyrahpaqpqpsivrlqiyifrhnla nasrgapese s 
 rs    k qtllkl lraap aaitqwlvaeswt glqwsvrynvmnglsp pqlqt g ma n 
 f     d p ffeg c       aaar lgrrsl f ps fdqk lm g k hlag         
       a                   n ee nrh   a    l  i    g f            
                                  g                  e            
© 1998-2023Legal notice