Dataset for protein classical BH3-containing proteins of organism Panthera leo

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------------------------------makqp---ss
mtrtspgtpkrprwewlwsgptrvpgtsmsseaghiwggchpqwyfitrsrviskgprtkavgwpqvprr-----sdv--
     m qken      lea ghrc agl g                 eqfeari  h     fe  egkgrrlgqvlvv
                                                                       emkrpqgrk
                                                                         e gecqe
                                                                         a      
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------cdreggqlqpaerppqlrpgaptslqteqq----------------s----p--
rpwvrgspsdisrptpagsvvppvve--l--------------q----l-a---a-gnpegegdrcpqgspq-pldp-ls
perplaqhrrgpkcfwlsrmtvsqcvme-addvfrnedgetgt-ehsl-v-nlf-ptvtveyygprwspnsrgqpacaar
  pge lap clhad   ele  aasethceslspavywseaal aqyprdrvwpmadlaal   g p g n rfrv rp
                         qas   pg l qplk f g  ggec papg                  mdqi mf
                           g         faa           d a                      g e 
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------p----c------p---c------l---asmrqpqavpagmr--pe
pgplftrsplfipglrpsslsdsatgylsfdtdrsgapms-gkstqt-spp-qafnhy-saprvr--lsglrldlqppeg
hlqfaplthccgfvrgstlqerkssqtfkpaspsq-vmlpadvteepqrlsypnagyrmplmptfkshasglprepeeir
lpsiqeemsvtwrmp vgptpgrprysgahtytqt llse eqqqgs vsfnghplaggvgtglvggcvqya nvessaa
eafegdd eprdm     e g m m p   qrnap srg   hhl q a mahgg   arek alcaatps   t gn  
d                                                    c          a    da   a ad  
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                       :                                        
i-------------------w-------iaqeLrrigDefnayypr--------------q----------wwrlll-l-
qeeeepspfrgrsrsappnl-qhraevq-grq-qcma-qlh-l---rvrlnsyqaaqqqr-sqswtrfirv-lq---y-v
h                   lar  aley-ak ---- k qt-tmwlrfprnrrvseamprhpqnr   psi--inrnii
v                          rt -- kals g lrsrnq p akragtrtpsql        miyrsw yfvh
t                           c mr   f  d  qrhkg        qppnrh         qtp pv mlal
                                         g fe         ehlhng         glf dr ca a
                                                       ea ga           a  k     

       330        
....:....|....:...
                  
-l--rler----------
r-awnaqenrggagprqn
nvll--a-lqnsynmsp 
skifps-wvparsile  
qggal ptgl are    
m   g hqa   pa    
l     gl          
© 1998-2022Legal notice