Dataset for protein classical BH3-containing proteins of organism Panthera leo

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C9D8H0_PMAIP1-      --------------------------------------------------
A0A8C8XJH6_HRK-01       --------------------------------------------------
A0A8C8Y6N0_BCL2L11      --------------------------------------------------
A0A8C8XBT3_BAD-01       --------------------------------------------------
A0A8C8WD49_BMF-01       --------------------------------------------------
A0A8C8WD49_BMF-02       MTRTSPGQKKRPRWEWLWEGPGRRCGASLSSEAGHIWGGCHPQWYFITRS
A0A8C9D8E2_BIK-01       --------------------------------------------------
A0A8C8WWE4_BBC3-01      --------------------------------------------------
A0A8C8Y6N0_BCL2L11      --------------------------------------------------
A0A8C8Y6N0_BCL2L11      --------------------------------------------------
A0A8C8Y6N0_BCL2L11      --------------------------------------------------
                                                                          

A0A8C9D8H0_PMAIP1-      -------------------------------------------------M
A0A8C8XJH6_HRK-01       -----------------------------MCPCPLHRGRGPPAV---CAC
A0A8C8Y6N0_BCL2L11      ------------------------------------MAKQPSDVSSECDR
A0A8C8XBT3_BAD-01       --------------------------------------------MGTPE-
A0A8C8WD49_BMF-01       --------------------------------------------MEPPQC
A0A8C8WD49_BMF-02       FVISIGPHFPQVEGKGERKGGVLQVRPWGRGQHPRCLHCTPAGEMEPPQC
A0A8C9D8E2_BIK-01       -----------------------------------------------MSH
A0A8C8WWE4_BBC3-01      ------------------------------------MARARQEGSSP-EP
A0A8C8Y6N0_BCL2L11      ------------------------------------MAKQPSDVSSECDR
A0A8C8Y6N0_BCL2L11      ------------------------------------MAKQPSDVSSECDR
A0A8C8Y6N0_BCL2L11      ------------------------------------MAKQPSDVSSECDR
                                                                          

A0A8C9D8H0_PMAIP1-      PGKRTRKSAQPSPARAPAEPEVE---------------------------
A0A8C8XJH6_HRK-01       SAGRLGLRSSAAQLTAARLKALGDE-------------------------
A0A8C8Y6N0_BCL2L11      EGGQLQPAERPPQLRPGAPTSLQTE-------------------------
A0A8C8XBT3_BAD-01       -NPLSAPTHVPGTGMSGTEQREARKGPRTKAVGWEQVPRRGRRLGRKRPR
A0A8C8WD49_BMF-01       VEELEDDVFQPEDGEPGTQ-------------------------------
A0A8C8WD49_BMF-02       VEELEDDVFQPEDGEPGTQ-------------------------------
A0A8C9D8E2_BIK-01       AGSLSRNVFLSTFLQEHGPEVLDVPGMTDLVEYYDPG-------------
A0A8C8WWE4_BBC3-01      VEGLARDGPRPFPLSRLVPSAVSC----------GLC-------------
A0A8C8Y6N0_BCL2L11      EGGQLQPAERPPQLRPGAPTSLQTEQQ-----------------------
A0A8C8Y6N0_BCL2L11      EGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRC-------------
A0A8C8Y6N0_BCL2L11      EGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRC-------------
                                  .                                       

A0A8C9D8H0_PMAIP1-      --------------------------------------------------
A0A8C8XJH6_HRK-01       --------------------------------------------------
A0A8C8Y6N0_BCL2L11      --------------------------------------------------
A0A8C8XBT3_BAD-01       PLASPSDISKADWAGSVTVPVAQATRAGLPQYWKEAAGPGQGPRDRAWAQ
A0A8C8WD49_BMF-01       ----PGSLLSANLFAQSQLDCPLSHLQLFP--LTHCCGPGLRPTSQEDKA
A0A8C8WD49_BMF-02       ----PGSLLSANLFAQSQLDCPLSHLQLFP--LTHCCGPGLRPTSQEDKA
A0A8C9D8E2_BIK-01       ----PSPNSNSPDDVAMRLAFIGDEMEVRWMMPRVGELPGMAMYSLAFTY
A0A8C8WWE4_BBC3-01      ----EPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG--PRSR
A0A8C8Y6N0_BCL2L11      --------------------------------------------------
A0A8C8Y6N0_BCL2L11      ----PQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDT
A0A8C8Y6N0_BCL2L11      ----PQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDT
                                                                          

A0A8C9D8H0_PMAIP1-      --------------------------------------------------
A0A8C8XJH6_HRK-01       --------------------------------------------LH----
A0A8C8Y6N0_BCL2L11      --------------------------------------------QQASMR
A0A8C8XBT3_BAD-01       SMFQIPEFEPSEQEDSSPTDRGLGPSPTGDRPRGPGKHQRTAPGLLGEAG
A0A8C8WD49_BMF-01       TQTLSP---------ASPSQGVMLPCGVTEEPQRL---------FYGNAG
A0A8C8WD49_BMF-02       TQTLSP---------ASPSQGVMLPCGVTEEPQRL---------FYGNAG
A0A8C9D8E2_BIK-01       NQTGLR------------------------------GVLRSLVDGLANLR
A0A8C8WWE4_BBC3-01      PRGPRP---------DGPQPSLSPAEQHLESPVPSAPG------ALAGGP
A0A8C8Y6N0_BCL2L11      DRSPAP----------------MSCDKSTQTPSPPCQAFNHYLSAMASMR
A0A8C8Y6N0_BCL2L11      DRSPAP----------------MSCDKSTQTPSPPCQAFNHYLSAMASMR
A0A8C8Y6N0_BCL2L11      DRSPAP----------------MSCDKSTQTPSPPCQAFNHYLSAMASMR
                                                                          

A0A8C9D8H0_PMAIP1-      --------------------------------------------------
A0A8C8XJH6_HRK-01       --------------------------------------------------
A0A8C8Y6N0_BCL2L11      QPQAVPA-------------------------------------------
A0A8C8XBT3_BAD-01       HQQGQPASSNHHGGAGAVETRSRHSSYPAGTEEDEGTEEEEPSPFRGRSR
A0A8C8WD49_BMF-01       YRLPLPA------------------SFPAGLPLGE---------------
A0A8C8WD49_BMF-02       YRLPLPA------------------SFPAGLPLGE---------------
A0A8C9D8E2_BIK-01       ENI-----------------------------------------------
A0A8C8WWE4_BBC3-01      TQAAPGV-------------------------------------------
A0A8C8Y6N0_BCL2L11      QPQAVPA-------------------------------------------
A0A8C8Y6N0_BCL2L11      QPQAVPA-------------------------------------------
A0A8C8Y6N0_BCL2L11      QPQAVPA-------------------------------------------
                                                                          

A0A8C9D8H0_PMAIP1-      --------------CAMQLRRFG---DKLN--------------------
A0A8C8XJH6_HRK-01       --QRTMW-------RRRARSRRAPAPGALPTYWPWLCAAAQVAALAAWLL
A0A8C8Y6N0_BCL2L11      DMRPEIW-------IAQELRRIG---DEFNAYYPRRLARVPASYI-----
A0A8C8XBT3_BAD-01       SAPPNLW---AALRYGRELRRMS---DEFQGSFKGLPRPKSAGTATQMRQ
A0A8C8WD49_BMF-01       QPPEGHWQHRAEVQIARKLQCIA---DQFH--------------RLHMQQ
A0A8C8WD49_BMF-02       QPPEGHWQHRAEVQIARKLQCIA---DQFH--------------RLHMQQ
A0A8C9D8E2_BIK-01       ----RIW-----------------------GFLTLR-----------NRV
A0A8C8WWE4_BBC3-01      RGEEEQW----AREIGAQLRRMA---DDLNALYERR-----------RQE
A0A8C8Y6N0_BCL2L11      DMRPEIW-------IAQELRRIG---DEFNAYYPRRVF------LNNYQA
A0A8C8Y6N0_BCL2L11      DMRPEIW-------IAQELRRIG---DEFNAYYPRRVF------LNNYQA
A0A8C8Y6N0_BCL2L11      DMRPEIW-------IAQELRRIG---DEFNAYYPR---------------
                                                                          

A0A8C9D8H0_PMAIP1-      -----------FRQKLMNLISKLFRSGT--------
A0A8C8XJH6_HRK-01       GRRNL-------------------------------
A0A8C8Y6N0_BCL2L11      ------------------------------------
A0A8C8XBT3_BAD-01       SPSWTRFIQSWWDRNL-----------GRGGSAPSQ
A0A8C8WD49_BMF-01       HQQNRR--RVWWQILLFLHNLALNAEENRNGAGPR-
A0A8C8WD49_BMF-02       HQQNRR--RVWWQILLFLHNLALNAEENRNGAGPR-
A0A8C9D8E2_BIK-01       SPNSGRGLALSLLLLVLLLGWGLHLLQ---------
A0A8C8WWE4_BBC3-01      EQQRHRPSPWRVLYNLIMGLLPLPRARGAPEMEPN-
A0A8C8Y6N0_BCL2L11      AEAQPQMIILRLLRYIVRLIWRLQR-----------
A0A8C8Y6N0_BCL2L11      AEAQPQMIILRLLRYIVRLIWRLQR-----------
A0A8C8Y6N0_BCL2L11      ---------------------RLEQ-----------
                                                            

© 1998-2023Legal notice