Dataset for protein classical BH3-containing proteins of organism Panthera leo

[Download (right click)] [Alignment] [Repertoires]

11 sequence(s)

>gnl|bcl2dbpro|A0A8C8WD49_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Panthera leo GN=BMF (length=278 residues).
MTRTSPGQKKRPRWEWLWEGPGRRCGASLSSEAGHIWGGCHPQWYFITRSFVISIGPHFPQVEGKGERKGGVLQVRPWGR
GQHPRCLHCTPAGEMEPPQCVEELEDDVFQPEDGEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCCGPGLRPTSQE
DKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGHWQHRAEVQIARKLQCIADQFHR
LHMQQHQQNRRRVWWQILLFLHNLALNAEENRNGAGPR
>gnl|bcl2dbpro|A0A8C8WD49_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Panthera leo GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGHWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRRRVW
WQILLFLHNLALNAEENRNGAGPR
>gnl|bcl2dbpro|A0A8C8WWE4_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Panthera leo GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRARGAPEMEPN
>gnl|bcl2dbpro|A0A8C8XBT3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Panthera leo GN=BAD (length=273 residues).
MGTPENPLSAPTHVPGTGMSGTEQREARKGPRTKAVGWEQVPRRGRRLGRKRPRPLASPSDISKADWAGSVTVPVAQATR
AGLPQYWKEAAGPGQGPRDRAWAQSMFQIPEFEPSEQEDSSPTDRGLGPSPTGDRPRGPGKHQRTAPGLLGEAGHQQGQP
ASSNHHGGAGAVETRSRHSSYPAGTEEDEGTEEEEPSPFRGRSRSAPPNLWAALRYGRELRRMSDEFQGSFKGLPRPKSA
GTATQMRQSPSWTRFIQSWWDRNLGRGGSAPSQ
>gnl|bcl2dbpro|A0A8C8XJH6_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Panthera leo GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|A0A8C8Y6N0_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Panthera leo GN=BCL2L11 (length=87 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQASMRQPQAVPADMRPEIWIAQELRRIGDEFNAYYPRRLA
RVPASYI
>gnl|bcl2dbpro|A0A8C8Y6N0_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Panthera leo GN=BCL2L11 (length=141 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAV
PADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAQPQMIILRLLRYIVRLIWRLQR
>gnl|bcl2dbpro|A0A8C8Y6N0_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Panthera leo GN=BCL2L11 (length=167 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRLEQ
>gnl|bcl2dbpro|A0A8C8Y6N0_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Panthera leo GN=BCL2L11 (length=197 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRVFLNNYQAAEAQPQMIILRLLRYIVRLIWRLQR
>gnl|bcl2dbpro|A0A8C9D8E2_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Panthera leo GN=BIK (length=148 residues).
MSHAGSLSRNVFLSTFLQEHGPEVLDVPGMTDLVEYYDPGPSPNSNSPDDVAMRLAFIGDEMEVRWMMPRVGELPGMAMY
SLAFTYNQTGLRGVLRSLVDGLANLRENIRIWGFLTLRNRVSPNSGRGLALSLLLLVLLLGWGLHLLQ
>gnl|bcl2dbpro|A0A8C9D8H0_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Panthera leo GN=PMAIP1 (length=54 residues).
MPGKRTRKSAQPSPARAPAEPEVECAMQLRRFGDKLNFRQKLMNLISKLFRSGT
© 1998-2022Legal notice