Dataset for protein classical BH3-containing proteins of organism Oryzias latipes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                 :.*:.:.  * : .*      .: .        *  *  .:.: *  *              *
mclsgisghssmaakftis dsesse vegg l-----dlgaa---agge eh hdrhslt pe -------------- 
           ys ppr                          gg g                  s              

        90       100       110       120       130       140       150       160
*   .*  * .:  .  :.*:            ::  .:   ... * *  :    .*:*. :.*:*     :   *: *
 tsng tr nsestastys dedlaredeagtptdglafrgrsksa p lwaakkyg q rrms e dslldkgem kv 

       170       180       190       200       210       220       230       240
. *..        **       . **..    *  .  :                                         
st aakqmlhsts  -------ny  shpeae eyshheshrtesddllgwlrcssditvshvtagfqlpftrnslfqgw
                                        l  m                                    

       250       260       
© 1998-2022Legal notice