Dataset for protein classical BH3-containing proteins of organism Oryzias latipes

[Download (right click)] [Edit] [Sequences] [Repertoires]

12 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P9K487_BMF-02      -----------------MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTP
A0A3P9K487_BMF-01      -----------------MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTP
A0A3B3HAU1_BMF-03      -----------------MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTP
A0A3B3HAU1_BMF-02      -----------------MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTP
A0A3B3HAU1_BMF-01      -----------------MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTP
A0A3B3HAU1_BMF-04      -----------------MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTP
A0A3P9ICE1_BMF-04      -----------------MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTP
A0A3P9ICE1_BMF-01      MCLSGISGHSSYSAPPRMDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTP
A0A3P9HNZ2_BAD-01      -----------MAAKFTISDDSESSEEVEGGKL-----DLGAAGGGGGGE
A0A3B3HDU2_BAD-01      -----------MAAKFTISDDSESSEEVEGGKL-----DLGAA---AGGE
A0A3P9KSL7_BAD-01      -----------MAAKFTISDDSESSEEVEGGKL-----DLGAA---AGGE
A0A3P9KSL7_BAD-02      -----------MAAKFTISDDSESSEEVEGGKL-----DLGAA---AGGE
                                        :.*:.:.  * : .*      .: .        

A0A3P9K487_BMF-02      GPALVPNNGMLLCGLSEEPRPLFYGNAGFRLHFPARFELAGDLEVRRHDR
A0A3P9K487_BMF-01      GPALVPNNGMLLCGLSEEPRPLFYGNAGFRLHFPARFELAGDLEVRRHDR
A0A3B3HAU1_BMF-03      GPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRRHDR
A0A3B3HAU1_BMF-02      GPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRRHDR
A0A3B3HAU1_BMF-01      GPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRRHDR
A0A3B3HAU1_BMF-04      GPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRRHDR
A0A3P9ICE1_BMF-04      GPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRRHDR
A0A3P9ICE1_BMF-01      GPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRRHDR
A0A3P9HNZ2_BAD-01      GEHLHDRHSLTLPEL--------------RLTSNGRTRLNSESTASTYSR
A0A3B3HDU2_BAD-01      GEHLHDRHSLTLPEL--------------RLTSNGRTRLNSESTASTYSR
A0A3P9KSL7_BAD-01      GEHLHDRHSLTLPEL--------------RLTSNGRTRLNSESTASTYSR
A0A3P9KSL7_BAD-02      GEHLHDRHSLTLPEL--------------RLTSNGRTRLNSESTASTYSR
                       *  *  .:.: *  *              **   .*  * .:  .  :.*

A0A3P9K487_BMF-02      E------------AERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRE
A0A3P9K487_BMF-01      E------------AERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRE
A0A3B3HAU1_BMF-03      E------------AERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRE
A0A3B3HAU1_BMF-02      E------------AERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRE
A0A3B3HAU1_BMF-01      E------------AERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRE
A0A3B3HAU1_BMF-04      E------------AERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRE
A0A3P9ICE1_BMF-04      E------------AERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRE
A0A3P9ICE1_BMF-01      E------------AERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRE
A0A3P9HNZ2_BAD-01      DEDLAREDEAGTPTDGLAFRGRSKSAPPALWAAKKYGQQLRRMSDEFDSL
A0A3B3HDU2_BAD-01      DEDLAREDEAGTPTDGLAFRGRSKSAPPALWAAKKYGQQLRRMSDEFDSL
A0A3P9KSL7_BAD-01      DEDLAREDEAGTPTDGLAFRGRSKSAPPALWAAKKYGQQLRRMSDEFDSL
A0A3P9KSL7_BAD-02      DEDLAREDEAGTPTDGLAFRGRSKSAPPALWAAKKYGQQLRRMSDEFDSL
                       :            ::  .:   ... * *  :    .*:*. :.*:*   

A0A3P9K487_BMF-02      RLQLYHRNQRNQGPV--------WWRLATALVSLLFDRGFIAGAGGAGQR
A0A3P9K487_BMF-01      RLQLYHRNQRNQGPV--------WWRLATALVSLLFDRGFIAGAGGAGQR
A0A3B3HAU1_BMF-03      RLQLYHRNQRNQGPV--------WWRLATALVSLLFDRGFIAGAGGAGQR
A0A3B3HAU1_BMF-02      RLQLYHRNQRNQGPV--------WWRLATALVSLLFDRGFIAGAGGAGQR
A0A3B3HAU1_BMF-01      RLQLYHRNQRNQGPV--------WWRLATALVSLLFDRGFIAGAGGAGQR
A0A3B3HAU1_BMF-04      RLQLYHRNQRNQGPV--------WWRLATALVSLLFDRGFIAGAGGAGQR
A0A3P9ICE1_BMF-04      RLQLYHRNQRNQGPV--------WWRLATALVSLLFDRGFIAGAGGAGQR
A0A3P9ICE1_BMF-01      RLQLYHRNQRNQGPV--------WWRLATALVSLLFDRGFIAGAGGAGQR
A0A3P9HNZ2_BAD-01      LDKGEMRKVRSTGAAKQMLHSTSWW-------NYLFSHPEAEGEYSHHES
A0A3B3HDU2_BAD-01      LDKGEMRKVRSTGAAKQMLHSTSWW-------NYLFSHPEAEGEYSHHES
A0A3P9KSL7_BAD-01      LDKGEMRKVRSTGAAKQMLHSTSWW-------NYLFSHPEAEGEYSHHES
A0A3P9KSL7_BAD-02      LDKGEMRKVRSTGAAKQMLHSTSWW-------NYLFSHPEAEGEYSHHES
                         :   *: *. *..        **       . **..    *  .  : 

A0A3P9K487_BMF-02      LSVMSD--------------------------------------------
A0A3P9K487_BMF-01      --------------------------------------------------
A0A3B3HAU1_BMF-03      --------------------------------------------------
A0A3B3HAU1_BMF-02      --------------------------------------------------
A0A3B3HAU1_BMF-01      --------------------------------------------------
A0A3B3HAU1_BMF-04      QSVVSD--------------------------------------------
A0A3P9ICE1_BMF-04      LSVLSD--------------------------------------------
A0A3P9ICE1_BMF-01      --------------------------------------------------
A0A3P9HNZ2_BAD-01      QRTE----------------------------------------------
A0A3B3HDU2_BAD-01      HRTE----------------------------------------------
A0A3P9KSL7_BAD-01      HRTENRDLLGWLRCSSDITVSHVTAGFQLPFTRNSLFQGWWFDLPVQDQR
A0A3P9KSL7_BAD-02      HRTENRDLLGWLRCSSDITVSHVTAGFQLPFTRNSLFQGWWFDLPVQDQR
                                                                         

A0A3P9K487_BMF-02      -----------------
A0A3P9K487_BMF-01      -----------------
A0A3B3HAU1_BMF-03      -----------------
A0A3B3HAU1_BMF-02      -----------------
A0A3B3HAU1_BMF-01      -----------------
A0A3B3HAU1_BMF-04      -----------------
A0A3P9ICE1_BMF-04      -----------------
A0A3P9ICE1_BMF-01      -----------------
A0A3P9HNZ2_BAD-01      -----------------
A0A3B3HDU2_BAD-01      -----------------
A0A3P9KSL7_BAD-01      RQQLQARQNFLEPSIRT
A0A3P9KSL7_BAD-02      RQQLQR-----------
                                        

© 1998-2020Legal notice