Dataset for protein classical BH3-containing proteins of organism Oryzias latipes

[Download (right click)] [Alignment] [Repertoires]

12 sequence(s)

>gnl|bcl2dbpro|A0A3B3HAU1_BMF-04 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=169 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQRQSVVSD
>gnl|bcl2dbpro|A0A3B3HAU1_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=163 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQR
>gnl|bcl2dbpro|A0A3B3HAU1_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=163 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQR
>gnl|bcl2dbpro|A0A3B3HAU1_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=163 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQR
>gnl|bcl2dbpro|A0A3B3HDU2_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oryzias latipes GN=BAD (length=164 residues).
MAAKFTISDDSESSEEVEGGKLDLGAAAGGEGEHLHDRHSLTLPELRLTSNGRTRLNSESTASTYSRDEDLAREDEAGTP
TDGLAFRGRSKSAPPALWAAKKYGQQLRRMSDEFDSLLDKGEMRKVRSTGAAKQMLHSTSWWNYLFSHPEAEGEYSHHES
HRTE
>gnl|bcl2dbpro|A0A3P9HNZ2_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oryzias latipes GN=BAD (length=167 residues).
MAAKFTISDDSESSEEVEGGKLDLGAAGGGGGGEGEHLHDRHSLTLPELRLTSNGRTRLNSESTASTYSRDEDLAREDEA
GTPTDGLAFRGRSKSAPPALWAAKKYGQQLRRMSDEFDSLLDKGEMRKVRSTGAAKQMLHSTSWWNYLFSHPEAEGEYSH
HESQRTE
>gnl|bcl2dbpro|A0A3P9ICE1_BMF-04 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=169 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQRLSVLSD
>gnl|bcl2dbpro|A0A3P9ICE1_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=180 residues).
MCLSGISGHSSYSAPPRMDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFR
LHFPARFELAGDLEVRRHDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATA
LVSLLFDRGFIAGAGGAGQR
>gnl|bcl2dbpro|A0A3P9K487_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=169 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLSEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQRLSVMSD
>gnl|bcl2dbpro|A0A3P9K487_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=163 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLSEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQR
>gnl|bcl2dbpro|A0A3P9KSL7_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oryzias latipes GN=BAD (length=227 residues).
MAAKFTISDDSESSEEVEGGKLDLGAAAGGEGEHLHDRHSLTLPELRLTSNGRTRLNSESTASTYSRDEDLAREDEAGTP
TDGLAFRGRSKSAPPALWAAKKYGQQLRRMSDEFDSLLDKGEMRKVRSTGAAKQMLHSTSWWNYLFSHPEAEGEYSHHES
HRTENRDLLGWLRCSSDITVSHVTAGFQLPFTRNSLFQGWWFDLPVQDQRRQQLQARQNFLEPSIRT
>gnl|bcl2dbpro|A0A3P9KSL7_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oryzias latipes GN=BAD (length=216 residues).
MAAKFTISDDSESSEEVEGGKLDLGAAAGGEGEHLHDRHSLTLPELRLTSNGRTRLNSESTASTYSRDEDLAREDEAGTP
TDGLAFRGRSKSAPPALWAAKKYGQQLRRMSDEFDSLLDKGEMRKVRSTGAAKQMLHSTSWWNYLFSHPEAEGEYSHHES
HRTENRDLLGWLRCSSDITVSHVTAGFQLPFTRNSLFQGWWFDLPVQDQRRQQLQR
© 1998-2020Legal notice