Dataset for protein Bmf of organism Oryzias latipes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                 ************************************************:**************
-----------------MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLaEEPRPLFYGNAGFR
mclsgisghssysappr                                                s              
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
LHFPARFELAGDLEVRRHDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATA
                                                                                
                                                                                
                                                                                

       170       180      
....:....|....:....|....:.
********************      
LVSLLFDRGFIAGAGGAGQR------
                    lsvvsd
                    q  m  
                       l  
© 1998-2020Legal notice