Dataset for protein Bmf of organism Oryzias latipes

[Download (right click)] [Alignment] [Repertoires]

11 sequence(s)

>gnl|bcl2dbpro|A0A3B3HAU1_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=163 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQR
>gnl|bcl2dbpro|A0A3B3HAU1_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=163 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQR
>gnl|bcl2dbpro|A0A3B3HAU1_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=163 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQR
>gnl|bcl2dbpro|A0A3B3HAU1_BMF-04 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=169 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQRQSVVSD
>gnl|bcl2dbpro|A0A3P9ICE1_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=180 residues).
MCLSGISGHSSYSAPPRMDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFR
LHFPARFELAGDLEVRRHDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATA
LVSLLFDRGFIAGAGGAGQR
>gnl|bcl2dbpro|A0A3P9ICE1_BMF-04 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=169 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQRLSVLSD
>gnl|bcl2dbpro|A0A3P9ICE1_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=163 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQR
>gnl|bcl2dbpro|A0A3P9ICE1_BMF-05 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=163 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQR
>gnl|bcl2dbpro|A0A3P9ICE1_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=163 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQR
>gnl|bcl2dbpro|A0A3P9K487_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=169 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLSEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQRLSVMSD
>gnl|bcl2dbpro|A0A3P9K487_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=163 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLSEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQR
© 1998-2020Legal notice