Dataset for protein Bmf of organism Oryzias latipes

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P9ICE1_BMF-01      MCLSGISGHSSYSAPPRMDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTP
A0A3P9K487_BMF-02      -----------------MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTP
A0A3P9K487_BMF-01      -----------------MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTP
A0A3B3HAU1_BMF-03      -----------------MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTP
A0A3B3HAU1_BMF-02      -----------------MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTP
A0A3B3HAU1_BMF-01      -----------------MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTP
A0A3B3HAU1_BMF-04      -----------------MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTP
A0A3P9ICE1_BMF-04      -----------------MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTP
                                        *********************************

A0A3P9ICE1_BMF-01      GPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRRHDR
A0A3P9K487_BMF-02      GPALVPNNGMLLCGLSEEPRPLFYGNAGFRLHFPARFELAGDLEVRRHDR
A0A3P9K487_BMF-01      GPALVPNNGMLLCGLSEEPRPLFYGNAGFRLHFPARFELAGDLEVRRHDR
A0A3B3HAU1_BMF-03      GPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRRHDR
A0A3B3HAU1_BMF-02      GPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRRHDR
A0A3B3HAU1_BMF-01      GPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRRHDR
A0A3B3HAU1_BMF-04      GPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRRHDR
A0A3P9ICE1_BMF-04      GPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRRHDR
                       ***************:**********************************

A0A3P9ICE1_BMF-01      EAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQ
A0A3P9K487_BMF-02      EAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQ
A0A3P9K487_BMF-01      EAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQ
A0A3B3HAU1_BMF-03      EAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQ
A0A3B3HAU1_BMF-02      EAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQ
A0A3B3HAU1_BMF-01      EAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQ
A0A3B3HAU1_BMF-04      EAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQ
A0A3P9ICE1_BMF-04      EAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQ
                       **************************************************

A0A3P9ICE1_BMF-01      GPVWWRLATALVSLLFDRGFIAGAGGAGQR------
A0A3P9K487_BMF-02      GPVWWRLATALVSLLFDRGFIAGAGGAGQRLSVMSD
A0A3P9K487_BMF-01      GPVWWRLATALVSLLFDRGFIAGAGGAGQR------
A0A3B3HAU1_BMF-03      GPVWWRLATALVSLLFDRGFIAGAGGAGQR------
A0A3B3HAU1_BMF-02      GPVWWRLATALVSLLFDRGFIAGAGGAGQR------
A0A3B3HAU1_BMF-01      GPVWWRLATALVSLLFDRGFIAGAGGAGQR------
A0A3B3HAU1_BMF-04      GPVWWRLATALVSLLFDRGFIAGAGGAGQRQSVVSD
A0A3P9ICE1_BMF-04      GPVWWRLATALVSLLFDRGFIAGAGGAGQRLSVLSD
                       ******************************      

© 1998-2020Legal notice