Dataset for protein classical BH3-containing proteins of organism Oryctolagus cuniculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------ssecrreggqlqpeerpp-------------pq----------------l------------------
mcpcmakqpsdvpavvdqsssvssqasglaqlrpgaptslqse--plptadpfaqsspqgp-grsvspgpldlmeclegs
    plhrmrppmgrrapkrrspglvraed          rtv rsnlswsvc hgqldpg tppaee df         
        gegmqckeelgddrff rdla           gqq eg  eger       ca a                 
               a c a d e ka             edg     a                               
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------spa-g-----------------h--------------
nqvalrlayigdevtlspltytvrrslrpsyssssylsfdysr---p-vllpstqtpsppcqafs-ylsamgkpwsrfcl
             mhrh rrifsgplsvltsqgkkltqtttdqtgstmscdkvgvhlesqvllynpwvr w a       
             ld f  fhcca g l  r edgafeslspprafq gmgscsl ea lrefwgn              
             a                a      a  c a   a     a                           
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                :               
-g-----p-p-p-------------------------------------------qw---iavqlrrrgdelharypr--
s-lrlsl-a-g-arpwvgsqppggpvtgvvpcpaprgplegvptpaapgvwgeeevlvve--arikwipypsaqqfh-rv
asypqpqaryfdtnsprcg lee                                thqtrtvtf slmlvkiypyt-wlr
q mgktp qsdcphlel e a                                  s ercclqe ailaqgfnlermccp
  f a k e a lgfc  a                                    e ah aeld  gk fdcdgcqe  h
               a                                                  a   c  d      
                                                                                

       250       260       270         
....:....|....:....|....:....|....:....
                                       
-------arp-p------ll-----l-------------
rqrsqqa---v-wsvlyn--rgalr-awsppwpwqgpnl
prqnyrwrnrswqrtywrwvpynwqvvrrmnrllmrrs 
llphrprpllqllqkilpffmhlvp plllhpggge r 
fangldnkeenaipiff   laian nggegadea    
  ee   ha k  m      c   a  adaa        
          g                            
© 1998-2020Legal notice