Dataset for protein classical BH3-containing proteins of organism Oryctolagus cuniculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------ssecrreggqlqpeerppqlrpgpltslqs--q-----------------------------------
mcpcmakqpsdvpavvdqsssvssqasglaet--eapltaspep-sqpegplgrpvspqgpllpscspgsnqvrsrlfyi
    plhrmrppmgrrapkrrspglvraedrqvv-taprwrvlgdgnldpgrtahgeegdldameale pfatalp aif
        gegmqckeelgddrff rdla gdq rs aq kiia     cd c                           
               a c a d e ka     g qc  a eaf       a                             
                                e       d                                       

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------drslrpmss-ks-qtpspppqafngylspvg------------------------------
vrrvsllprtytsyfsfdt-l-pats-cd--tl---ysctpsthvwlamsvtsqsqalpaytrprtwvcqvhvtcillfl
gdesh hslsssg      k-lqvr-y-rrkr-rttslqsllstgmpwlpsqrlvlvea wlllhsnlage        f
   md f  rhcc      gph   twrgdaltqslkalrgiqkffnscclmlepktk  dgcgerci            
   l               e g    aqe  aserdc an ap   gfaakheagar                       
                   a d           afa   g  a       aaa                           

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------g-p---p-p----------------------------------------------w------
ysrgvrswgyyprrvpls-y-lpl-q-gparlwlgsqpvrgpvtgvvpcpaprgplegvptpaapgvwgeeeq-rrrlvv
wgpwfpfnacpwscpfrpnlraarersqmvnprvlrylpgl                               v qmhisl
rrn deaa af   fc n fdwsp k f pifpr e iee                                s nleaea
k i              a     e a d  g a  a a                                  a aha   
  h                                                                             

       250       260       270       280       290     
....:....|....:....|....:....|....:....|....:....|....:
                                                       
-------------------------------------------------------
qiswrpyslypqyhrlhrqqhqqrrrrvwwrvlynllmhnlplprgpnrpgmgpr
pprrqlvgihdeqec  l ee  nhnpsp qi    flgl a ngdegadeae n
dlglmgqdcaa f                                          
  a kapc                                               
                                                       
© 1998-2021Legal notice