Dataset for protein classical BH3-containing proteins of organism Oryctolagus cuniculus

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A5F9C629_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Oryctolagus cuniculus GN=PMAIP1 (length=54 residues).
MPGKRARKRSQSSPKRAPAELEVECATQLRIIGDKLDLRRKLLNLISKFFNFVP
>gnl|bcl2dbpro|A0A5F9C9V3_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Oryctolagus cuniculus GN=BCL2L11 (length=194 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQSEPQGNPEGDRCAHGSPQGPLAPSASPGPFATRSPLFIFVRRS
SLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADTRPETWIAQELRRIGDEFNAYYP
RRVFLNNYPAAEEQPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A5F9C9V3_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Oryctolagus cuniculus GN=BCL2L11 (length=146 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQSEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGKQSLGKTK
PAYGCLHSCVCGVHVTCILLFLKGRGFPSAGCFPRCPPRPGLDWARPKPGAWNLALSLPPGWQGPS
>gnl|bcl2dbpro|A0A5F9DGT6_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Oryctolagus cuniculus GN=BBC3 (length=182 residues).
MARARQEGSSPEPVEGLARDGPRPLPAWSPGALGRVLRPSASGKSLLESDCSPRAAAGGLLPASSHSGFPAPLPRPGPPR
PPRGSQLEGGPVTGVVPCPAPRGPLEGVPTPAAPGVWGEEEQWAREIVAQLRWMAYDLYAQYERRQEEQQRHRPSPWRVL
YNLLMGLLPLPRGPGAPEMEPN
>gnl|bcl2dbpro|G1SR62_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oryctolagus cuniculus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPQSLLSADPFAQSQLDCPLGRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPANFALGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHLQQHQQNRNRVW
WQILLFLHNLALNGDENRDGAGPR
>gnl|bcl2dbpro|G1T7W1_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Oryctolagus cuniculus GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSAAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|G1TZR9_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Oryctolagus cuniculus GN=BIK (length=166 residues).
MSEVRPGSRDLFQEALLDEQVPEPLLTAEVPGLTRPVEEGDLDLMECLEGSNQVALRLAYIGDEMDLHPRRYTSARLLVP
SYSLAFTYSQTGFTGVLGSVGLHLASLVELWSPWVRAWGAPWSRFCLSGLPLSPPQPDPAGLWVGAQASWVDISLRPVGC
HPEQHC
© 1998-2022Legal notice