Dataset for protein classical BH3-containing proteins of organism Oryctolagus cuniculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A5F9C9V3_BCL2L11      ----MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQSEPQ-----
A0A5F9C9V3_BCL2L11      ----MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQSEPQGNPEG
G1TZR9_BIK-01           ------------MSEVRPGSRDLFQEALLDEQVPEPLLTAEV-------P
A0A5F9DGT6_BBC3-01      ------------MARARQEGSSPEPVEGLARDGPRPLPAWSP-------G
G1SR62_BMF-01           --------MEPPQCVEELEDDVFQPEDGEPGTQPQSLLSADPFAQSQLDC
A0A5F9C629_PMAIP1-      -----------MPGKRARKRSQSSPKRAPAELEVECATQLRIIGD-----
G1T7W1_HRK-01           MCPCPLHRGRGPPAVCACSAGRLGLRSAAAQL---TAARLKALGD-----
                                                                          

A0A5F9C9V3_BCL2L11      -------------------------------------------------D
A0A5F9C9V3_BCL2L11      DRCAHGSPQGPLAPSASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTD
G1TZR9_BIK-01           GLTRPVEEGDLDLMECLEGSNQVALRLAYIGDEMDLHPRRYTS------A
A0A5F9DGT6_BBC3-01      ALGR-----------------------------V----------------
G1SR62_BMF-01           PLGR-----------------------------LHLFPLTHCC------G
A0A5F9C629_PMAIP1-      -------------------------------------------------K
G1T7W1_HRK-01           -------------------------------------------------E
                                                                          

A0A5F9C9V3_BCL2L11      RSPAPMSCDKSTQTPSPPCQAFNHYLSAMGKQSLGKTKPAYGCLHSCVCG
A0A5F9C9V3_BCL2L11      RSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADTRPETWIAQ
G1TZR9_BIK-01           RLLVPSYS----LAFTYSQTGFTGVLGSVGLHLASLVE------------
A0A5F9DGT6_BBC3-01      --LRPSASGKSLLESDCSPRAAAGGLLPAS--------------------
G1SR62_BMF-01           PGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRL------------
A0A5F9C629_PMAIP1-      LDLRR-----------KLLNLISKFFNFVP--------------------
G1T7W1_HRK-01           LHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL--
                                                                          

A0A5F9C9V3_BCL2L11      VHVTCILLFLKGRGFPSAGCFPRCPPRPGLDWARPKPG------------
A0A5F9C9V3_BCL2L11      E--------LRRIGDEFNAYYPRRVFLNNYPAAEEQPQMVILRLLRYIVR
G1TZR9_BIK-01           ---------LWSPWVRAWGAPWSRFCLSGLPLSPPQPDPAGLWVGAQA--
A0A5F9DGT6_BBC3-01      -----------SH--------------SGFPAPLPRPGPPRPPRGSQLEG
G1SR62_BMF-01           ---------FYGN--------------AGYRLPLPASFPANFALGEQPPE
A0A5F9C629_PMAIP1-      --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
                                                                          

A0A5F9C9V3_BCL2L11      --------------------------------AWNLALSLPPGWQGPS--
A0A5F9C9V3_BCL2L11      L-------------------------------VWRMH-------------
G1TZR9_BIK-01           --------------------------------SW-----VDISLRPVGCH
A0A5F9DGT6_BBC3-01      GPVTGVVPCPAPRGPLEGVPTPAAPGVWGEEEQWAREIVAQLRWMAYDLY
G1SR62_BMF-01           G-------------------------------QWQHRAEVQIARKLQCIA
A0A5F9C629_PMAIP1-      --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
                                                                          

A0A5F9C9V3_BCL2L11      ---------------------------------------------
A0A5F9C9V3_BCL2L11      ---------------------------------------------
G1TZR9_BIK-01           PEQHC----------------------------------------
A0A5F9DGT6_BBC3-01      AQYER--RQEEQQRHRPSPWRVLYNLLMGLLPLPRGPGAPEMEPN
G1SR62_BMF-01           DQFHRLHLQQHQQNRNRVWWQIL--LFLHNLALNGDENRDGAGPR
A0A5F9C629_PMAIP1-      ---------------------------------------------
G1T7W1_HRK-01           ---------------------------------------------
                                                                     

© 1998-2022Legal notice