Dataset for protein classical BH3-containing proteins of organism Oryctolagus cuniculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1T7W1_HRK-01          ---------------------MCPCPLHRGRGPPAVCACSAGRLGLRSAA
G1TZR9_BIK-01          MSEVRPGSRDLFQEA--LLDEQVPEPLLTAEVPGLTRPVEEGDLDLMECL
G1SR62_BMF-01          --MEPPQCVEELEDD--VFQPEDGEPGTQP--QSLLSADPFAQSQLDCPL
G1SSY0_BCL2L11-01      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQSEPQ---------
G1SSY0_BCL2L11-02      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQSEPQGNPEGDRCA
                                                *           .            

G1T7W1_HRK-01          AQLTAARLK--------------------------------ALGDELHQR
G1TZR9_BIK-01          EGSNQVALRLAYIGDEMDLHPRRYTSARLLVPSYSLAFTYSQTGFTGVLG
G1SR62_BMF-01          GRLHLFPLTHCCGPGLRPTSQE----------------------------
G1SSY0_BCL2L11-01      ---------------------------------------------DRSPA
G1SSY0_BCL2L11-02      HGSPQGPLAPSASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPA
                                                                         

G1T7W1_HRK-01          TMWRRRAR--SRRAPAPGALPTYWPWLCAAA-------------------
G1TZR9_BIK-01          SVGLHLASLVELWSPWVRAWGAPWSRFCLSGLPLSPP-------------
G1SR62_BMF-01          ----DKAT--QTLSP-------------------ASPSQGVMLPCGVTEE
G1SSY0_BCL2L11-01      PMSCDKST--QTPSPPCQAFNHYLSAMGKQSLGKTKPAYGCLHSCVCGVH
G1SSY0_BCL2L11-02      PMSCDKST--QTPSPPCQAFNHYLSAMASMRQSQAEPADTRPETWIAQE-
                             :   .  :*                                   

G1T7W1_HRK-01          ----------------------------------QVAALAAWLLGRRNL-
G1TZR9_BIK-01          ----------------------------------QPDPAGLWVGAQASWV
G1SR62_BMF-01          PQRLFYGNAGYRLPLPASFPANFALGEQPPEGQWQHRAEVQIARKLQCIA
G1SSY0_BCL2L11-01      VTCILLFLKGRGFPSAGCFPRCPPRPGLDWA---RPKPG-----------
G1SSY0_BCL2L11-02      -------LRRIGDEFNAYYPRRVFLNNYPAA---EEQPQMVILRLLRYIV
                                                            .            

G1T7W1_HRK-01          -------------------------------------------
G1TZR9_BIK-01          DISLRPVGCHPEQHC----------------------------
G1SR62_BMF-01          DQFHRLHLQQHQQNRNRVWWQILLFLHNLALNGDENRDGAGPR
G1SSY0_BCL2L11-01      --AWNLALSLPPGWQ-------------------------GPS
G1SSY0_BCL2L11-02      RLVWRMH------------------------------------
                                                                  

© 1998-2020Legal notice