Dataset for protein classical BH3-containing proteins of organism Oryctolagus cuniculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A5F9C9V3_BCL2L11      ----MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQSEPQ-----
A0A5F9C9V3_BCL2L11      ----MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQSEPQGNPEG
G1TZR9_BIK-01           ------------MSEVRPGSRDLFQEALLD----------EQVPEPLLTA
A0A5F9DGT6_BBC3-01      ------------MARARQEGSSPEPVEGLA----------RDGPRPLPAW
G1SR62_BMF-01           --------MEPPQCVEELEDDVFQPEDGEP----------GTQPQSLLSA
A0A5F9C629_PMAIP1-      -----------MPGKRARKRSQSSPKRAPA--------------------
G1T7W1_HRK-01           MCPCPLHRGRGPPAVCACSAGRLGLRSAAA--------------------
                                                                          

A0A5F9C9V3_BCL2L11      --------------------------------------------------
A0A5F9C9V3_BCL2L11      DRCAHGSPQGPLAPSASPGPF----------------------ATRSPLF
G1TZR9_BIK-01           EV-------PGLTRPVEEGDLDLMECLEGSNQVALRLAYIGDEMDLHPRR
A0A5F9DGT6_BBC3-01      SP-------GALGR-----------------------------V------
G1SR62_BMF-01           DPFAQSQLDCPLGR-----------------------------LHLFPLT
A0A5F9C629_PMAIP1-      --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
                                                                          

A0A5F9C9V3_BCL2L11      ---------------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSA
A0A5F9C9V3_BCL2L11      IFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSA
G1TZR9_BIK-01           YTSARLLVPSYS----LAFTYSQTGFTGVLGSVGLHLASLVELWSPWVRA
A0A5F9DGT6_BBC3-01      ------LRPSASGKSLLESDCSPRAAAGGLLPAS----------SH----
G1SR62_BMF-01           HCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGN----
A0A5F9C629_PMAIP1-      --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
                                                                          

A0A5F9C9V3_BCL2L11      MGK-------QSLGKTKPAYGCLHSCVCG---------------------
A0A5F9C9V3_BCL2L11      M---------ASMRQSQAEPADTRPE------------------------
G1TZR9_BIK-01           WGAPWSRFCLSGLPLSPPQPDPAGLWVGAQA-------------------
A0A5F9DGT6_BBC3-01      ----------SGFPAPLPRPGPPRPPRGSQLEGGPVTGVVPCPAPRGPLE
G1SR62_BMF-01           ----------AGYRLPLPASFPANFALGEQPPEG----------------
A0A5F9C629_PMAIP1-      --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
                                                                          

A0A5F9C9V3_BCL2L11      ---------------VHVTCILLFLKGRGFPSAGCFPRCPPRPGLDWARP
A0A5F9C9V3_BCL2L11      ---------------TW---IAQELRRIGDEFNAYYPRRVFLNNYPAAEE
G1TZR9_BIK-01           ---------------SW-----VDISLRPVGCHPEQHC------------
A0A5F9DGT6_BBC3-01      GVPTPAAPGVWGEEEQWAREIVAQLRWMAYDLYAQYER--RQEEQQRHRP
G1SR62_BMF-01           ---------------QWQHRAEVQIARKLQCIADQFHRLHLQQHQQNRNR
A0A5F9C629_PMAIP1-      ---------------ELEVECATQLRIIGDKLDLRR-----------KLL
G1T7W1_HRK-01           ---------------QL---TAARLKALGDELHQRTMWRRRARSRRAPAP
                                                :                         

A0A5F9C9V3_BCL2L11      KP---------GAWNLALSLPPGWQGPS-
A0A5F9C9V3_BCL2L11      QPQMVILRLLRYIVRLVWRMH--------
G1TZR9_BIK-01           -----------------------------
A0A5F9DGT6_BBC3-01      SPWRVLYNLLMGLLPLPRGPGAPEMEPN-
G1SR62_BMF-01           VWWQIL--LFLHNLALNGDENRDGAGPR-
A0A5F9C629_PMAIP1-      NLISKFFNFVP------------------
G1T7W1_HRK-01           GALPTYWPWLCAAAQVAALAAWLLGRRNL
                                                     

© 1998-2022Legal notice