Dataset for protein classical BH3-containing proteins of organism Ornithorhynchus anatinus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                             *.     . .      *: .*  *           
-----------------------------------------makqPsdlnsecdseggrlePaegPaqP-----------
mkwpwpgrrygcarslsagrmelsqyeeeleeltglemlqipvfh etrvdvstpqp---d s-a lt gqpysytvtsp
                                     efedde e  epga  lag  gpa  q   g  glgrhlhgql
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      *   *   :                                                                 
------PqlrPgaptsirtqyq----------------------------------------------------drsppp
plfsll grg ppralssedptgnlsgggescsqgpfppsssprpfatrsplfifvrrssllsrsssgyfsfdt------
d apha cc   la hlq akp                                                   ftwtlsr
                                                                          sql   
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                        *  .               .*    . .  * :.:*.    :*. :.*:*   .  
vscdkstqtpsphcqafnhylsamAsir---------------qP-qsvpedmrPeiwiAq----eLrrigDeFnasycp
--p--g------------------ gyhlssltsfpgdpslges frgrswsrp imqv rrygrk qcms q hrthtq
lp-st-vrlkegvtrlpsrppysh ee                e  pea he  l             a   dclfqg
aa aq pma c sgeenrelfdge                                                        
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
rr-----------------ldvrpe-vrrgngstppvtlrppprwrt---------------------------------
--trntnhvwwrvrplsgmfanksgrlqpplpfcaer-ehekngfg-avtvswrsedprvftsssaeqtravvaspiyny
 hqgmrgglvfmgll lhl------lkgq kspr---q-----f--rvlrsw nrssssaq                   
                 en  lgmdenpl inagtagdtqrhs-ptm                                 
                 d            g   l a  l     d                                  

        
....:...
        
--------
aidtvphg
        
        
        
© 1998-2021Legal notice