Dataset for protein classical BH3-containing proteins of organism Ornithorhynchus anatinus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                             *.     . .      *: .*  *           
-----------------------------------------makqPsdlnsecdseggrlePaegPaqP-----------
mkwpwpgrrygcarslsagrmelsqyeeeleeltglemlqipvfh etrvdvstpqp---d s-a lt gqpysytvtsp
                                     efedde e  epga  lag  gpa  q   g  glgrhlhgql
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      *   *   :                                                                 
------PqlrPgaptsirtqyq----------------------------------------------------drsppp
plfsll grg ppralssedptgnlsgggescsqgpfppsssprpfatrsplfifvrrssllsrsssgyfsfdt------
d apha cc   la hlq akp                                                   ftwtlsr
                                                                          sql   
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                        *  .               .*    . .  * :.:*.    :*. :.*:*   .  
vscdkstqtpsphcqafnhylsamAsir---------------qP-qsvpedmrPeiwiAq----eLrrigDeFnasycp
--p--g------------------ gyhlssltsfpgdpslges frgrswsrp imqv rrygrk qcms q hrtht-
lp-st-vrlkegvtrlpsrppysh ee                e  pea he  l             a   dclfqq
aa aq pma c sgeenrelfdge                                                        
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                        .                                                       
rr-----------------glvrpk-vgrgqps-------------------------------tssstertrnvvgt--
--trntnhvwwrvrplshmlaldnessr-kl-pngfcapvtlhppprwrtavtvswrsedprvf-pera-qpkaffaspi
 hqgmrgglvfmgll lenfdpgmdln q--n-r                               ----t-e------lr
                 d       el l ig                                 lpqlql-spwtrv  
                          a   g                                  aagd   hggpdm  

       330 
....:....|.
           
-----------
ynyaidtvphg
swwnrssssaq
           
           
© 1998-2020Legal notice