Dataset for protein classical BH3-containing proteins of organism Ornithorhynchus anatinus

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A6I8NCK5_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Ornithorhynchus anatinus GN=BCL2L11 (length=156 residues).
MAKQPSDLNSECDSEGGRLEPAEGPAQPPQLRPGAPTSIRTQYQDRSPPPVSCDKSTQTPSPHCQAFNHYLSAMASIRQP
QSVPEDMRPEIWIAQELRRIGDEFNASYCPRRTGMTGGLVFMGRLLSDMFAVRPEVRRGLPSTPERTEREKNFFGT
>gnl|bcl2dbpro|A0A6I8NCK5_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Ornithorhynchus anatinus GN=BCL2L11 (length=183 residues).
MAKQPSDLNSECDSEGGRLEPAEGPAQPPQLRPGAPTSIRTQYQDRSPPPVSCDKSTQTPSPHCQAFNHYLSAMASIRQP
QSVPEDMRPEIWIAQELRRIGDEFNASYCPRRGLLDNKSGRKQPPNGFCAPVTLHPPPRWRTAVTVSWRSEDPRVFTSSS
AEQTRAVVASPIYNYAIDTVPHG
>gnl|bcl2dbpro|A0A6I8NCK5_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Ornithorhynchus anatinus GN=BCL2L11 (length=153 residues).
MAKQPSDLNSECDSEGGRLEPAEGPAQPPQLRPGAPTSIRTQYQASIRQPQSVPEDMRPEIWIAQELRRIGDEFNASYCP
RRGLLDNKSGRKQPPNGFCAPVTLHPPPRWRTAVTVSWRSEDPRVFTSSSAEQTRAVVASPIYNYAIDTVPHG
>gnl|bcl2dbpro|A0A6I8NCK5_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Ornithorhynchus anatinus GN=BCL2L11 (length=142 residues).
MAKQPSDLNSECDSEGGRLEPAEGPAQPPQLRPGAPTSIRTQYQDRSPPPVSCDKSTQTPSPHCQAFNHYLSAMASIRQP
QSVPEDMRPEIWIAQELRRIGDEFNASYCPRREMLDVRPDLLGLGINSTLPGDTLPHPGPDM
>gnl|bcl2dbpro|A0A6I8NCK5_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Ornithorhynchus anatinus GN=BCL2L11 (length=191 residues).
MAKQPSDLNSECDSEGGRLEPAEGPAQPPQLRPGAPTSIRTQYQGNLSGGGESCSQGPFPPSSSPRPFATRSPLFIFVRR
SSLLSRSSSGYFSFDTDRSPPPVSCDKSTQTPSPHCQAFNHYLSAMASIRQPQSVPEDMRPEIWIAQELRRIGDEFNASY
CPRRFAVRPEVRRGLPSTPERTEREKNFFGT
>gnl|bcl2dbpro|A0A6I8NF73_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Ornithorhynchus anatinus GN=BMF (length=216 residues).
MKWPWPGRRYGCARSLSAGRMELSQYEEELEELTGLEELEDDVFHPETPVAESLAQPGGPAPAAPLTPGQPYSYLVGQLP
LFPLAPCCGPGLRTLSQEDKTTQTLSPAAPSQGVMLPCGVTEEPRRLFYGHAGYRLSSLTSFPGDPSLGEEPPEAPWERR
PEMQVARKLQCIADQFHRLHTQRHQRNRNHVWWRVLPLLHNLALGMEENGQGGGPR
>gnl|bcl2dbpro|A0A6I8NVP2_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Ornithorhynchus anatinus GN=BAD (length=169 residues).
MFQIPEFEPSERGDVCTPGGDPSQAPAGPGGLGRHTHTSPDLASHLPGRRPPPAAHLSEAPPFSWLPPRLPPATGPRAKE
PSGRLNSEPPDSEAEEHSPFRGRSHSAPPILWVAQRYGRELRRMSDEFDCTFQGLPRPKSAGTAAQLQRPSGWTRVLRSW
WNRSSSSAQ
© 1998-2021Legal notice