Dataset for protein classical BH3-containing proteins of organism Ornithorhynchus anatinus

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A6I8NF73_BMF-01       MKWPWPGRRYGCARSLSAGRMELSQYEEELEELTGLEELEDDVFHPETPV
A0A6I8NVP2_BAD-01       -------------------------------------MFQIPEFEPSERG
A0A6I8NCK5_BCL2L11      -----------------------------------------MAKQPSDLN
A0A6I8NCK5_BCL2L11      -----------------------------------------MAKQPSDLN
A0A6I8NCK5_BCL2L11      -----------------------------------------MAKQPSDLN
A0A6I8NCK5_BCL2L11      -----------------------------------------MAKQPSDLN
A0A6I8NCK5_BCL2L11      -----------------------------------------MAKQPSDLN
                                                                     *.   

A0A6I8NF73_BMF-01       AESLAQPGGPAPA-APLTPGQPYSYLVGQLPLFPLAPCCGPGLRTLSQED
A0A6I8NVP2_BAD-01       DVCTPGG---DPSQAPAGPGGLGRHTHTSPDLASHLPGRRPPPAAHLSEA
A0A6I8NCK5_BCL2L11      SECDSEGGRLEPAEGPAQP-----------------PQLRPGAPTSIRTQ
A0A6I8NCK5_BCL2L11      SECDSEGGRLEPAEGPAQP-----------------PQLRPGAPTSIRTQ
A0A6I8NCK5_BCL2L11      SECDSEGGRLEPAEGPAQP-----------------PQLRPGAPTSIRTQ
A0A6I8NCK5_BCL2L11      SECDSEGGRLEPAEGPAQP-----------------PQLRPGAPTSIRTQ
A0A6I8NCK5_BCL2L11      SECDSEGGRLEPAEGPAQP-----------------PQLRPGAPTSIRTQ
                          . .      *: .*  *                 *   *   :     

A0A6I8NF73_BMF-01       KT------------------------------------------------
A0A6I8NVP2_BAD-01       PP------------------------------------------------
A0A6I8NCK5_BCL2L11      YQGNLSGGGESCSQGPFPPSSSPRPFATRSPLFIFVRRSSLLSRSSSGYF
A0A6I8NCK5_BCL2L11      YQ------------------------------------------------
A0A6I8NCK5_BCL2L11      YQ------------------------------------------------
A0A6I8NCK5_BCL2L11      YQ------------------------------------------------
A0A6I8NCK5_BCL2L11      YQ------------------------------------------------
                                                                          

A0A6I8NF73_BMF-01       ----TQTLSPAAPSQGVMLPCGVTEEPRRLFYGHAGYRLSSLTSFPGDPS
A0A6I8NVP2_BAD-01       ---FSWLPPRLPPATGPRAKEPSGRLNSEPPDSEAEEH------------
A0A6I8NCK5_BCL2L11      SFDTDRSPPPVSCDKSTQTPSPHCQAFNHYLSAMASIR------------
A0A6I8NCK5_BCL2L11      ----------------------------------ASIR------------
A0A6I8NCK5_BCL2L11      ----DRSPPPVSCDKSTQTPSPHCQAFNHYLSAMASIR------------
A0A6I8NCK5_BCL2L11      ----DRSPPPVSCDKSTQTPSPHCQAFNHYLSAMASIR------------
A0A6I8NCK5_BCL2L11      ----DRSPPPVSCDKSTQTPSPHCQAFNHYLSAMASIR------------
                                                          *  .            

A0A6I8NF73_BMF-01       LGEEP-PEAPWERRPEMQVAR----KLQCIADQFHRLHTQRHQRNRNHVW
A0A6I8NVP2_BAD-01       ---SPFRGRSHSAPPILWVAQRYGRELRRMSDEFDCTFQG----------
A0A6I8NCK5_BCL2L11      ---QP-QSVPEDMRPEIWIAQ----ELRRIGDEFNASYCPRR--------
A0A6I8NCK5_BCL2L11      ---QP-QSVPEDMRPEIWIAQ----ELRRIGDEFNASYCPRR--------
A0A6I8NCK5_BCL2L11      ---QP-QSVPEDMRPEIWIAQ----ELRRIGDEFNASYCPRR--------
A0A6I8NCK5_BCL2L11      ---QP-QSVPEDMRPEIWIAQ----ELRRIGDEFNASYCPRR--------
A0A6I8NCK5_BCL2L11      ---QP-QSVPEDMRPEIWIAQ----ELRRIGDEFNASYCPRRTGMTGGLV
                           .*    . .  * :.:*.    :*. :.*:*   .            

A0A6I8NF73_BMF-01       WRVLPLLHNLALGMEENGQGGGPR--------------------------
A0A6I8NVP2_BAD-01       ----------------LPRPKSAGTAAQLQRPSGWTRVLRSWWNRSSSSA
A0A6I8NCK5_BCL2L11      ---------FAVRPE-VRRGLPSTPERTEREKNFFGT-------------
A0A6I8NCK5_BCL2L11      -------GLLDNKSGRKQPPNGFCAPVTLHPPPRWRTAVTVSWRSEDPRV
A0A6I8NCK5_BCL2L11      -------GLLDNKSGRKQPPNGFCAPVTLHPPPRWRTAVTVSWRSEDPRV
A0A6I8NCK5_BCL2L11      -------EMLDVRPDLLGLGINSTLPGDTLPHPGPDM-------------
A0A6I8NCK5_BCL2L11      FMGRLLSDMFAVRPE-VRRGLPSTPERTEREKNFFGT-------------
                                                                          

A0A6I8NF73_BMF-01       ----------------------------
A0A6I8NVP2_BAD-01       Q---------------------------
A0A6I8NCK5_BCL2L11      ----------------------------
A0A6I8NCK5_BCL2L11      FTSSSAEQTRAVVASPIYNYAIDTVPHG
A0A6I8NCK5_BCL2L11      FTSSSAEQTRAVVASPIYNYAIDTVPHG
A0A6I8NCK5_BCL2L11      ----------------------------
A0A6I8NCK5_BCL2L11      ----------------------------
                                                    

© 1998-2021Legal notice