Dataset for protein classical BH3-containing proteins of organism Oncorhynchus tshawytscha

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                              .:           .                                    
-----------------------------mddeeedvg--epsshswtthfrEikyhdrgttt--------------p--
msmssiytyqsngstlslqmsymdhthdcvgenpdtmfeqseddpcgnpaysggqlesvssqmredtqdrstqtstm-sp
 mhgqrrqnilcslpilielftrptirgkys s-pggnaadraestdlkqsp fpqqnllgir             i ns
  dai niifh  c fi diaq fqns ss  ps----vt-kvqq ag pnt  eig-ae vp             g  a
                             e  ln e sl rg     r gmc  df h   rd                 
                                ch      pd                                      
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                          .    :                                
-l--------------------------sqrprpl-----gfrlrfpsesqvvsdvgrrs----q-----------dgam
v-plpsrspvfrtlsrssnnmlpcgvddavessi-fygnasgqthlyasfercgqqqpmgdtefedaitpteygggrnps
lvgfqeghdlmvpqghnnsgyfsfdsq niplag lkd ket apsn rqvqthar kleqvqvvave rrdedvwpegp
i ars    i         dn       enqg    h    e v m  q  pqell eqdnh grptm n  d a e rl
a                            m                     mmd    grg   n q           er
                             h                     i       p      l             
                                                   a                            

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      .             * :*. :.*:*                                                 
frlrsqpapp--alwaekkiGqqLrrigDeF----------------------------r------------------pl
epynrrsqltavtrspavcy rk qlms q hqehlqvvriptvtdctaqlksterlyh-nqrvmrgnlqqmhqepafdt
r sqqs pqergdmri tr  ce  e     nnlfihl                 qaagtqgsnaqete ekwllyghlv
h gep  ee  aeq m il            yd  v g                   fl hrqdvla             
  m e        d   a                                        c   hae               
    a                                                                           
                                                                                

       250       260       270       280       
....:....|....:....|....:....|....:....|....:..
*                                              
Wl----------------rlsrgllsflwsrea-ag-----------
 wdkgepkrgispggvkqevisawftlifepr-a--reragwrpqkt
 m   vrrgsv   errgl-agr--qi-l-qneievggdpslygper
 s             g  k ---cy-- -r-- p qcs lhf     
 i                c tvp  gw vqek l             
                     m   f   n h               
                                               
© 1998-2023Legal notice