Dataset for protein classical BH3-containing proteins of organism Oncorhynchus tshawytscha

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C8F2F2_BCL2L11      -MHGQIYIYFLNSLTLILDLSYRPQNRGKSGESHPGGGAASRAEPSDNPQ
A0A8C8FY48_BCL2L11      MSDSSRRQNQSNGSTILIE-------RGKYGELNPGGGAASGAEPTDNPQ
A0A8C8EXP2_BAD-01       ----------------------MDHIHDCVDEC--------ESDHSGTTH
A0A8C8GG62_BAD-01       -------------------MAQMFTISDSESEPSEEVGETEKDQSSAGKG
A0A8C8H7F1_BAD-02       ----------------------MDHTHDCVDDNPETMNEQDESDHSGTTH
A0A8C8H7F1_BAD-01       --MAIINTIIHCGCPFSLQIFTMDHTHDCVDDNPETMNEQDESDHSGTTH
A0A8C8CQZ6_BMF-01       -----------------------------MDDEEDDVFV-PDSSHCWRTA
A0A8C8FNK5_BMF-01       -----------------------------MDDEEEDMSLQRPVSQCWGTP
A0A8C8F9Y2_BMF-02       -----------------------------MDDEEDDVF--EPDSHCWLTA
A0A8C8F9Y2_BMF-01       -----------------------------MDDEEDDVF--EPDSHCWLTA
                                                      .:           .      

A0A8C8F2F2_BCL2L11      SCEGDQQSLGGIM-------------IPNSLLGFQSRSPVFRTLSRSSSG
A0A8C8FY48_BCL2L11      FSEGEQQSRGGIM-------------MPNSLLGFQSRSPLFRTLSRSSSG
A0A8C8EXP2_BAD-01       NSEFQLH-VSTTM-------------------------------------
A0A8C8GG62_BAD-01       MTGGPIGHALTVP-------------------------------------
A0A8C8H7F1_BAD-02       YPEFQLHNVSSTR-------------------------------------
A0A8C8H7F1_BAD-01       YPEFQLHNVSSTR-------------------------------------
A0A8C8CQZ6_BMF-01       FREIKYEDRGTQT--------------PSPALALP-------------ND
A0A8C8FNK5_BMF-01       FREIKFHDRESRDREDTQDRSTQTSTGPNAIVPRSEGHDIMVPQGHNNNN
A0A8C8F9Y2_BMF-02       FREIKYEDRGTQT--------------PSPVLPLP-------------NN
A0A8C8F9Y2_BMF-01       FREIKYEDRGTQT--------------PSPVLPLP-------------NN
                                                                          

A0A8C8F2F2_BCL2L11      YFSFDSD-SIPSSPLLKDNKSTQTPSPSSQVITHALQRMS----RALETR
A0A8C8FY48_BCL2L11      YFSFDSD-SIPSSPLLKD-KSTQTPSPSSQVMTHALQRMS----QAQETN
A0A8C8EXP2_BAD-01       --------SNRPRP------GERVRLYSESQVCSQVGKRENTEFQDVMTP
A0A8C8GG62_BAD-01       --------EMRLAG------EGRLRMNSESQAQELQGRGPGVEGVPT---
A0A8C8H7F1_BAD-02       --------SVRPRP------GGRARLYSESQVCSQVGRRDDTEFQDAITP
A0A8C8H7F1_BAD-01       --------SVRPRP------GGRARLYSESQVCSQVGRRDDTEFQDAITP
A0A8C8CQZ6_BMF-01       MLPCGV--AQEPRPLFYGNAGFRLHFPARFEQVGDRGPQEQHQVE-----
A0A8C8FNK5_BMF-01       NFPCGVQDNHQGRILFHGNAGFRLHFPARFEPMDDRGERR----N-----
A0A8C8F9Y2_BMF-02       MLPCGV--AQEPRPLFYGNAGFRLHFPAQFERVGDQGPLG----E-----
A0A8C8F9Y2_BMF-01       MLPCGV--AQEPRPLFYGNAGFRLHFPAQFERVGDQGPLG----E-----
                                              .    :                      

A0A8C8F2F2_BCL2L11      RDYDVWPNPLRPYRASPPPTAADMRPEILIGQELQRIGDEFNNLFIHG--
A0A8C8FY48_BCL2L11      RDYDAWPNPLHPYRPRPPPTAGDMWPETLIGQELQRIGDEFNDLFIHG--
A0A8C8EXP2_BAD-01       TEDGGGDGASFRGRSQSAPP--ALWAAKKYGCQLRRMSDEF---------
A0A8C8GG62_BAD-01       ------DGASFRGRSQSAPP--ALWAAKRYGRQLRRMSDEF---------
A0A8C8H7F1_BAD-02       TEEGGGDGAPFRSRSQSAPP--TLWAAKKYGRQLRRMSDEF---------
A0A8C8H7F1_BAD-01       TEEGGGDGAPFRSRSQSAPP--TLWAAKKYGRQLRRMSDEF---------
A0A8C8CQZ6_BMF-01       ------RGRMERLQQQPQQP--AQSMEVCIGQKLQLIGDQFYQEHLQL--
A0A8C8FNK5_BMF-01       ------EEERRRMEERPEEERVEDSAEARIGRKLREIGDQFHQEHVQL--
A0A8C8F9Y2_BMF-02       ------RGGMERLNRQPQLP--ARSIEVCIGQKLQLIGDQFHQEHLQVVR
A0A8C8F9Y2_BMF-01       ------RGGMERLNRQPQLP--ARSIEVCIGQKLQLIGDQFHQEHLQV--
                                        .             * :*. :.*:*         

A0A8C8F2F2_BCL2L11      ---------------RLAGRNGQVAQGNLQQMHQEPAFLLWM--------
A0A8C8FY48_BCL2L11      ---------------RLAGRNGHVAQANLQEMHQEPAFLLWM--------
A0A8C8EXP2_BAD-01       --------------------------------------DTWLDKGEPKRG
A0A8C8GG62_BAD-01       --------------------------------------DTWLDKGVRRGS
A0A8C8H7F1_BAD-02       --------------------------------------DTWLDKGEPKRG
A0A8C8H7F1_BAD-01       --------------------------------------DTWLDKGEPKRG
A0A8C8CQZ6_BMF-01       -----------------YHRNQRNMR------------PLWW--------
A0A8C8FNK5_BMF-01       -----------------FLRHQRDVL------------PVWI--------
A0A8C8F9Y2_BMF-02       IPTVTDCTAQLKSTEQAYCTQRSAERETEQQKWLLYGHPLWS--------
A0A8C8F9Y2_BMF-01       -----------------YHRNQRNMR------------PLWW--------
                                                                *         

A0A8C8F2F2_BCL2L11      -------GLLIGRLLQIILRRR---------------
A0A8C8FY48_BCL2L11      -------GLLIGRLLQIILQRR---------------
A0A8C8EXP2_BAD-01       ISPGGGKQKVSRGWFSFLWSPKEAEGRE---------
A0A8C8GG62_BAD-01       V--GERRGE----------------------------
A0A8C8H7F1_BAD-02       ISPGGVKQEVSRGWFSFLWSPNEAEGRE---------
A0A8C8H7F1_BAD-01       ISPGGVKQEVSRGWFSFLWSPNEAEGRE---------
A0A8C8CQZ6_BMF-01       --------RLASALLTLLFEQEAIAGRGRAGWR----
A0A8C8FNK5_BMF-01       --------RLTMALYGFLFNREAPAV---PHLRGQER
A0A8C8F9Y2_BMF-02       --------CLSVPCLFWLVSEHALAQCSDLSFYPPKT
A0A8C8F9Y2_BMF-01       --------RLASALLTLLFEQEAIAGGGRAGWR----
                                                             

© 1998-2023Legal notice