Dataset for protein classical BH3-containing proteins of organism Oncorhynchus tshawytscha

[Download (right click)] [Alignment] [Repertoires]

10 sequence(s)

>gnl|bcl2dbpro|A0A8C8CQZ6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oncorhynchus tshawytscha GN=BMF (length=164 residues).
MDDEEDDVFVPDSSHCWRTAFREIKYEDRGTQTPSPALALPNDMLPCGVAQEPRPLFYGNAGFRLHFPARFEQVGDRGPQ
EQHQVERGRMERLQQQPQQPAQSMEVCIGQKLQLIGDQFYQEHLQLYHRNQRNMRPLWWRLASALLTLLFEQEAIAGRGR
AGWR
>gnl|bcl2dbpro|A0A8C8EXP2_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oncorhynchus tshawytscha GN=BAD (length=147 residues).
MDHIHDCVDECESDHSGTTHNSEFQLHVSTTMSNRPRPGERVRLYSESQVCSQVGKRENTEFQDVMTPTEDGGGDGASFR
GRSQSAPPALWAAKKYGCQLRRMSDEFDTWLDKGEPKRGISPGGGKQKVSRGWFSFLWSPKEAEGRE
>gnl|bcl2dbpro|A0A8C8F2F2_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Oncorhynchus tshawytscha GN=BCL2L11 (length=221 residues).
MHGQIYIYFLNSLTLILDLSYRPQNRGKSGESHPGGGAASRAEPSDNPQSCEGDQQSLGGIMIPNSLLGFQSRSPVFRTL
SRSSSGYFSFDSDSIPSSPLLKDNKSTQTPSPSSQVITHALQRMSRALETRRDYDVWPNPLRPYRASPPPTAADMRPEIL
IGQELQRIGDEFNNLFIHGRLAGRNGQVAQGNLQQMHQEPAFLLWMGLLIGRLLQIILRRR
>gnl|bcl2dbpro|A0A8C8F9Y2_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Oncorhynchus tshawytscha GN=BMF (length=194 residues).
MDDEEDDVFEPDSHCWLTAFREIKYEDRGTQTPSPVLPLPNNMLPCGVAQEPRPLFYGNAGFRLHFPAQFERVGDQGPLG
ERGGMERLNRQPQLPARSIEVCIGQKLQLIGDQFHQEHLQVVRIPTVTDCTAQLKSTEQAYCTQRSAERETEQQKWLLYG
HPLWSCLSVPCLFWLVSEHALAQCSDLSFYPPKT
>gnl|bcl2dbpro|A0A8C8F9Y2_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oncorhynchus tshawytscha GN=BMF (length=159 residues).
MDDEEDDVFEPDSHCWLTAFREIKYEDRGTQTPSPVLPLPNNMLPCGVAQEPRPLFYGNAGFRLHFPAQFERVGDQGPLG
ERGGMERLNRQPQLPARSIEVCIGQKLQLIGDQFHQEHLQVYHRNQRNMRPLWWRLASALLTLLFEQEAIAGGGRAGWR
>gnl|bcl2dbpro|A0A8C8FNK5_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oncorhynchus tshawytscha GN=BMF (length=193 residues).
MDDEEEDMSLQRPVSQCWGTPFREIKFHDRESRDREDTQDRSTQTSTGPNAIVPRSEGHDIMVPQGHNNNNNFPCGVQDN
HQGRILFHGNAGFRLHFPARFEPMDDRGERRNEEERRRMEERPEEERVEDSAEARIGRKLREIGDQFHQEHVQLFLRHQR
DVLPVWIRLTMALYGFLFNREAPAVPHLRGQER
>gnl|bcl2dbpro|A0A8C8FY48_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Oncorhynchus tshawytscha GN=BCL2L11 (length=214 residues).
MSDSSRRQNQSNGSTILIERGKYGELNPGGGAASGAEPTDNPQFSEGEQQSRGGIMMPNSLLGFQSRSPLFRTLSRSSSG
YFSFDSDSIPSSPLLKDKSTQTPSPSSQVMTHALQRMSQAQETNRDYDAWPNPLHPYRPRPPPTAGDMWPETLIGQELQR
IGDEFNDLFIHGRLAGRNGHVAQANLQEMHQEPAFLLWMGLLIGRLLQIILQRR
>gnl|bcl2dbpro|A0A8C8GG62_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oncorhynchus tshawytscha GN=BAD (length=129 residues).
MAQMFTISDSESEPSEEVGETEKDQSSAGKGMTGGPIGHALTVPEMRLAGEGRLRMNSESQAQELQGRGPGVEGVPTDGA
SFRGRSQSAPPALWAAKRYGRQLRRMSDEFDTWLDKGVRRGSVGERRGE
>gnl|bcl2dbpro|A0A8C8H7F1_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oncorhynchus tshawytscha GN=BAD (length=156 residues).
MDHTHDCVDDNPETMNEQDESDHSGTTHYPEFQLHNVSSTRSVRPRPGGRARLYSESQVCSQVGRRDDTEFQDAITPTEE
GGGDGAPFRSRSQSAPPTLWAAKKYGRQLRRMSDEFDTWLDKGEPKRGISPGGVKQEVSRGWFSFLWSPNEAEGRE
>gnl|bcl2dbpro|A0A8C8H7F1_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oncorhynchus tshawytscha GN=BAD (length=176 residues).
MAIINTIIHCGCPFSLQIFTMDHTHDCVDDNPETMNEQDESDHSGTTHYPEFQLHNVSSTRSVRPRPGGRARLYSESQVC
SQVGRRDDTEFQDAITPTEEGGGDGAPFRSRSQSAPPTLWAAKKYGRQLRRMSDEFDTWLDKGEPKRGISPGGVKQEVSR
GWFSFLWSPNEAEGRE
© 1998-2023Legal notice