Dataset for protein Bmf of organism Oncorhynchus tshawytscha

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****:*:      *:** *.*****: ** :.               *.. :. .             *: :****   
MDDEEdDvf--epdShCWlTaFREIKyeDRgtqt--------------Pspvlplp-------------NnmlPCGV--a
     e msvqrdv q  r p     fh  esrdredtqdrstqtstg naivarseghdimvpqghnn dnf    qdn
         l p s    g                                a                            
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:: * **:***********.** :.*.*       :     *:: .*:      * *. **.**. *****:***:*:  
qepRpLFyGNAGFRLHFPArFErvgDrGplg----erggmeRlnrqPqlp--arSiEvcIGqKLqlIGDQFhQEHlQv--
hqg i  h           q  qmd q errqhqvneerrr mqqr eqerveq m ar  r  re     y   v lvr
                      p      qe       e    ee   e    d a                        
                                                                                

       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
                 :  :.                *:*  *: .    *..  * *            
-----------------yhrnqrnmr------------PlWwrLasalltlLfeqeAiAg-gragwr----
iptvtdctaqlksteqafltqrsdvleteqqkwllygh v sc tvpcygw vsrh p vr--pslypqkt
                  h  ae                 sm   ff  n l qgsdlhf gper
                                                            c          
© 1998-2023Legal notice