Dataset for protein Bmf of organism Oncorhynchus tshawytscha

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C8CQZ6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oncorhynchus tshawytscha GN=BMF (length=164 residues).
MDDEEDDVFVPDSSHCWRTAFREIKYEDRGTQTPSPALALPNDMLPCGVAQEPRPLFYGNAGFRLHFPARFEQVGDRGPQ
EQHQVERGRMERLQQQPQQPAQSMEVCIGQKLQLIGDQFYQEHLQLYHRNQRNMRPLWWRLASALLTLLFEQEAIAGRGR
AGWR
>gnl|bcl2dbpro|A0A8C8F9Y2_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Oncorhynchus tshawytscha GN=BMF (length=194 residues).
MDDEEDDVFEPDSHCWLTAFREIKYEDRGTQTPSPVLPLPNNMLPCGVAQEPRPLFYGNAGFRLHFPAQFERVGDQGPLG
ERGGMERLNRQPQLPARSIEVCIGQKLQLIGDQFHQEHLQVVRIPTVTDCTAQLKSTEQAYCTQRSAERETEQQKWLLYG
HPLWSCLSVPCLFWLVSEHALAQCSDLSFYPPKT
>gnl|bcl2dbpro|A0A8C8F9Y2_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oncorhynchus tshawytscha GN=BMF (length=159 residues).
MDDEEDDVFEPDSHCWLTAFREIKYEDRGTQTPSPVLPLPNNMLPCGVAQEPRPLFYGNAGFRLHFPAQFERVGDQGPLG
ERGGMERLNRQPQLPARSIEVCIGQKLQLIGDQFHQEHLQVYHRNQRNMRPLWWRLASALLTLLFEQEAIAGGGRAGWR
>gnl|bcl2dbpro|A0A8C8FNK5_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oncorhynchus tshawytscha GN=BMF (length=193 residues).
MDDEEEDMSLQRPVSQCWGTPFREIKFHDRESRDREDTQDRSTQTSTGPNAIVPRSEGHDIMVPQGHNNNNNFPCGVQDN
HQGRILFHGNAGFRLHFPARFEPMDDRGERRNEEERRRMEERPEEERVEDSAEARIGRKLREIGDQFHQEHVQLFLRHQR
DVLPVWIRLTMALYGFLFNREAPAVPHLRGQER
© 1998-2023Legal notice