Dataset for protein Bmf of organism Oncorhynchus tshawytscha

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C8CQZ6_BMF-01      MDDEEDDVFV-PDSSHCWRTAFREIKYEDRGTQT--------------PS
A0A8C8FNK5_BMF-01      MDDEEEDMSLQRPVSQCWGTPFREIKFHDRESRDREDTQDRSTQTSTGPN
A0A8C8F9Y2_BMF-02      MDDEEDDVF--EPDSHCWLTAFREIKYEDRGTQT--------------PS
A0A8C8F9Y2_BMF-01      MDDEEDDVF--EPDSHCWLTAFREIKYEDRGTQT--------------PS
                       *****:*:      *:** *.*****: ** :.               *.

A0A8C8CQZ6_BMF-01      PALALP-------------NDMLPCGV--AQEPRPLFYGNAGFRLHFPAR
A0A8C8FNK5_BMF-01      AIVPRSEGHDIMVPQGHNNNNNFPCGVQDNHQGRILFHGNAGFRLHFPAR
A0A8C8F9Y2_BMF-02      PVLPLP-------------NNMLPCGV--AQEPRPLFYGNAGFRLHFPAQ
A0A8C8F9Y2_BMF-01      PVLPLP-------------NNMLPCGV--AQEPRPLFYGNAGFRLHFPAQ
                       . :. .             *: :****   :: * **:***********.

A0A8C8CQZ6_BMF-01      FEQVGDRGPQEQHQVERGRMERLQQQPQQP--AQSMEVCIGQKLQLIGDQ
A0A8C8FNK5_BMF-01      FEPMDDRGERR----NEEERRRMEERPEEERVEDSAEARIGRKLREIGDQ
A0A8C8F9Y2_BMF-02      FERVGDQGPLG----ERGGMERLNRQPQLP--ARSIEVCIGQKLQLIGDQ
A0A8C8F9Y2_BMF-01      FERVGDQGPLG----ERGGMERLNRQPQLP--ARSIEVCIGQKLQLIGDQ
                       ** :.*.*       :     *:: .*:      * *. **.**. ****

A0A8C8CQZ6_BMF-01      FYQEHLQL-------------------YHRNQRNMR------------PL
A0A8C8FNK5_BMF-01      FHQEHVQL-------------------FLRHQRDVL------------PV
A0A8C8F9Y2_BMF-02      FHQEHLQVVRIPTVTDCTAQLKSTEQAYCTQRSAERETEQQKWLLYGHPL
A0A8C8F9Y2_BMF-01      FHQEHLQV-------------------YHRNQRNMR------------PL
                       *:***:*:                   :  :.                *:

A0A8C8CQZ6_BMF-01      WWRLASALLTLLFEQEAIAGRGRAGWR----
A0A8C8FNK5_BMF-01      WIRLTMALYGFLFNREAPAV---PHLRGQER
A0A8C8F9Y2_BMF-02      WSCLSVPCLFWLVSEHALAQCSDLSFYPPKT
A0A8C8F9Y2_BMF-01      WWRLASALLTLLFEQEAIAGGGRAGWR----
                       *  *: .    *..  * *            

© 1998-2023Legal notice