Dataset for protein Bim of organism Oncorhynchus mykiss

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                           ****** ***:**** .* :********:********
-------------------------------------------GGGAASrAEPtDNPQssEweQQSRGGIMmPNSLLGFQ
mtlhrqnnknsltlildlsyrrqnqsngstiliergkygelnp      g   s    fc gd        i        

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****:***************** ********* ************:********.* **.***    .*** *..**.**
SRSPvFRTLSRSSSGYFSFDSDsIPSSPLLKD-KSTQTPSPSSQVmTHALQRMSrAqETrRDY---hvWPNpLrsYRpRP
    l                 f         n            i        q l  n   gkada   l hp  a  

       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
****.**.** **************: ***         *:. .   :   . : ::   : *       . .
PPTAgDMwPEtLIGQELQRIGDEFNnlFIH--------qVsryttqqmsqvtyyllytyrviGr------rrr
    a  r  i              dh   rrlagrngg aqgnlpalhlepafciwmgllg allqiilkdk
© 1998-2023Legal notice