Dataset for protein Bim of organism Oncorhynchus mykiss

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C7V9R7_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Oncorhynchus mykiss GN=BCL2L11 (length=190 residues).
GGGAASRAEPSDNPQSCEWDQQSRGGIMIPNSLLGFQSRSPVFRTLSRSSSGYFSFDSDFIPSSPLLKDNKSTQTPSPSS
QVITHALQRMSRALETRRDYGKAHVWPNPLRPYRARPPPTAADMRPEILIGQELQRIGDEFNNLFIHRRLAGRNGQVAQG
NLQQMHQEPAFLLWMGLLIGRLLQIILRRR
>gnl|bcl2dbpro|A0A8L0DSD4_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Oncorhynchus mykiss GN=BCL2L11 (length=215 residues).
MTLHRQNNKNSLTLILDLSYRRQNQSNGSTILIERGKYGELNPGGGAASGAEPTDNPQFSEGEQQSRGGIMMPNSLLGFQ
SRSPLFRTLSRSSSGYFSFDSDSIPSSPLLKDKSTQTPSPSSQVMTHALQRMSQAQETNRDYDAWPNLLHSYRPRPPPTA
GDMWPETLIGQELQRIGDEFNDHFIHGVSRYTTPALSLVTYYCIYTYRVGGAKDK
© 1998-2023Legal notice