Dataset for protein Bim of organism Oncorhynchus mykiss

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C7V9R7_BCL2L11      -------------------------------------------GGGAASR
A0A8L0DSD4_BCL2L11      MTLHRQNNKNSLTLILDLSYRRQNQSNGSTILIERGKYGELNPGGGAASG
                                                                   ****** 

A0A8C7V9R7_BCL2L11      AEPSDNPQSCEWDQQSRGGIMIPNSLLGFQSRSPVFRTLSRSSSGYFSFD
A0A8L0DSD4_BCL2L11      AEPTDNPQFSEGEQQSRGGIMMPNSLLGFQSRSPLFRTLSRSSSGYFSFD
                        ***:**** .* :********:************:***************

A0A8C7V9R7_BCL2L11      SDFIPSSPLLKDNKSTQTPSPSSQVITHALQRMSRALETRRDYGKAHVWP
A0A8L0DSD4_BCL2L11      SDSIPSSPLLKD-KSTQTPSPSSQVMTHALQRMSQAQETNRDY---DAWP
                        ** ********* ************:********.* **.***    .**

A0A8C7V9R7_BCL2L11      NPLRPYRARPPPTAADMRPEILIGQELQRIGDEFNNLFIHRRLAGRNGQV
A0A8L0DSD4_BCL2L11      NLLHSYRPRPPPTAGDMWPETLIGQELQRIGDEFNDHFIH--------GV
                        * *..**.******.**.** **************: ***         *

A0A8C7V9R7_BCL2L11      AQGNLQQMHQEPAFLLWMGLLIGRLLQIILRRR
A0A8L0DSD4_BCL2L11      SRYTTPALSLVTYYCIYTYRVGGA------KDK
                        :. .   :   . : ::   : *       . .

© 1998-2023Legal notice