Dataset for protein Bim of organism Oncorhynchus mykiss

[Download (right click)] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A8L0DSD4_BCL2L11-01      MTLHRQNNKNSLTLILDLSYRRQNQSNGSTILIERGKYGELNPGGGAASG
A0A8C7V9R7_BCL2L11-01      -------------------------------------------GGGAASR
                                                                      ****** 

A0A8L0DSD4_BCL2L11-01      AEPTDNPQFSEGEQQSRGGIMMPNSLLGFQSRSPLFRTLSRSSSGYFSFD
A0A8C7V9R7_BCL2L11-01      AEPSDNPQSCEWDQQSRGGIMIPNSLLGFQSRSPVFRTLSRSSSGYFSFD
                           ***:**** .* :********:************:***************

A0A8L0DSD4_BCL2L11-01      SDSIPSSPLLKD-KSTQTPSPSSQVMTHALQRMSQAQETNRDYD---AWP
A0A8C7V9R7_BCL2L11-01      SDFIPSSPLLKDNKSTQTPSPSSQVITHALQRMSRALETRRDYGKAHVWP
                           ** ********* ************:********:* **.***.   .**

A0A8L0DSD4_BCL2L11-01      NLLHSYRPRPPPTAGDMWPETLIGQELQRIGDEFNDHFIHGV--------
A0A8C7V9R7_BCL2L11-01      NPLRPYRARPPPTAADMRPEILIGQELQRIGDEFNNLFIHRRLAGRNGQV
                           * *:.**.******.** ** **************: ***          

A0A8L0DSD4_BCL2L11-01      ------SRYTTPALSLVTYYCIYTYRVGGAKDK
A0A8C7V9R7_BCL2L11-01      AQGNLQQMHQEPAFLLWMGLLIGRLLQIILRRR
                                 . :  **: *     *        : :

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice