Dataset for protein classical BH3-containing proteins of organism Oncorhynchus kisutch

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mprlswppelklgtkiqglfrvkhmcnnvvflsslplfsfsplsalspslflslcplslpslsalsrsplslsiplplsl
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
pslspslflslcplslspslflslcplslspslflslcplslspslfpslsalslslhpssplslhpssplslpsmrstc
                                                                           llgl 
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                            :                   
------------------------------------eddmf--spssscwstefretkygerstgt--------------
psvslsnrststsvslplslssplprltnsssmddem-qvsti-dveqepreavgtiekedsgpqkredtqdrstqtsga
lls   allphl iphhf clmtvhlqplrnpltvs-a---rrrnq-rgstipserghfdqlqa-g            tg
                     i  g  nhkl i lilemsylqq-ddn-egdli--fynh fnsr-              
                                     sldhvhem- -d---h-     s  e- d              
                                         i pcn h    -      p  hl                
                                           d   e                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                    :    :                      
-s---p-----------------m-p-gv-ggqsgrplf----rgnagfrlrfpsesqsvpdqgrlpd------------
p-pal-lpnpqgsegpqqsrgnn-l-csmt-fpirhastvtlsyssseg--hmsarfeaqgsspprkgnkstqtpspssq
angveatdeghfimve ghnnginm n-llda-epsvvarpemhlag y v-lnfd dvielv lgrn          h 
  aiv rs   sc  d      d f   -q -hq-ni  tmsn prp e a  y q  rmsqr eqge            
  r   s                 i      n -h       i               pcd   k eq            
                                 l                        q       d             
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                              * :*. :.*:*                       
--tegmerm--------d-----------rprspsappalwaekriGrqLrrigDeFd----------------------
vmvhalqt-sraqetnr-gasfpnplhpyqgqpqatsv----avly qk qlms q hqehlqlvriptvtdctaqlkst
 irgfepvltqtedggg ydaw    r  eesleeraidmsp tc  ce  e     ndlfihg                
 ee eqdarrp l  r    v         s q pergedr  ak            yn  v v                
    r   inm         p         a    q mt    i                                    
         q                           a                                          
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-twldrnqrvrr-------q----plWwrllisl------------------------------ltqlflrea-------
e--ygkgepraqkslqqmk-epaslv-mgytfarketegrererigrrggwaylfshqetttrn-l-ii-qrrpavrgrp
 rlalthgmnvvinpggahlmvkfrs isfawgpspaqrwr                    hehy-t--p---iygisda
 qafh qrhkmlata evw ltgh-g fckvsrhn n                           tpl pngssefrgpsv
    c   sd-gg e ak  ky   - ya smpc                              rgf veepns qe  m
        q-e-e    g         s   v                                pfw es h l pc  l
        ca                                                        i  g          

       
....:..
       
-------
swrgqer
rlappkt
ghynkap
lg     
 f     
       
© 1998-2022Legal notice