Dataset for protein classical BH3-containing proteins of organism Oncorhynchus kisutch

[Download (right click)] [Alignment] [Repertoires]

13 sequence(s)

>gnl|bcl2dbpro|A0A8C7DT45_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oncorhynchus kisutch GN=BAD (length=197 residues).
MAQMFTISDSESEPSEEVGETEKDQSSAGKGMTGGPIGHALTVPEMRLAGEGRLRMNSESQAQELQGRGPGVEGMPTDGA
SFRGRSQSAPPALWAAKRYGRQLRRMSDEFDTWLDKGEMRRVKSAGAAKQMTKSPSWWAYLFSHKETERWRRERIGRRGG
WAYLFSHQETTHRNRTTIEPRSSEYREGDVSHANKAP
>gnl|bcl2dbpro|A0A8C7DT45_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oncorhynchus kisutch GN=BAD (length=150 residues).
MAQMFTISDSESEPSEEVGETEKDQSSAGKGMTGGPIGHALTVPEMRLAGEGRLRMNSESQAQELQGRGPGVEGMPTDGA
SFRGRSQSAPPALWAAKRYGRQLRRMSDEFDTWLDKGRCYCKVFRCSPNQPPTLPGGPNSFPIPSMLGAG
>gnl|bcl2dbpro|A0A8C7DT45_BAD-03 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oncorhynchus kisutch GN=BAD (length=357 residues).
MPRLSWPPELKLGTKIQGLFRVKHMCNNVVFLSSLPLFSFSPLSALSPSLFLSLCPLSLPSLSALSRSPLSLSIPLPLSL
PSLSPSLFLSLCPLSLSPSLFLSLCPLSLSPSLFLSLCPLSLSPSLFPSLSALSLSLHPSSPLSLHPSSPLSLPSLLSLC
PLSSLSALSPSLSIPLPLSLSIPLPLLTHSSSIDVSMAQMFTISDSESEPSEEVGETEKDQSSAGKGMTGGPIGHALTVP
EMRLAGEGRLRMNSESQAQELQGRGPGVEGMPTDGASFRGRSQSAPPALWAAKRYGRQLRRMSDEFDTWLDKGEMRRVKS
AGAAKQMTKSPSWWAYLFSHKETETEHTPIIPPRSSE
>gnl|bcl2dbpro|A0A8C7FH91_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oncorhynchus kisutch GN=BMF (length=164 residues).
MDDEEDDVFVPDSSHCWRTAFREIKYEDRGTQTPSPALALPNDMLPCGVAQEPRPLFYGNAGFRLHFPARFEQVGDQGPQ
EQHQVERGRMERLQQQPQQPAQSMEVCIGQKLQLIGDQFYQEHLQLYHRNQRNMRPLWWRLASALLTLLFEQEAIAGRGR
AGWR
>gnl|bcl2dbpro|A0A8C7G467_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oncorhynchus kisutch GN=BMF (length=159 residues).
MDDEEDDVFEPDSRCWRTAFREIKYEDRGTQTPSPVLPLPNNMLPCGVAQEPRPLFYGNAGFRLHFPAQFERVGDQGPLG
ERGGMERLNRQPQLPARSIEVCIGQKLQLIGDQFHQEHLQVYHRNQRNMRPLWWRLASALLTLLFEQEAIAGGGRAGWR
>gnl|bcl2dbpro|A0A8C7G467_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Oncorhynchus kisutch GN=BMF (length=194 residues).
MDDEEDDVFEPDSRCWRTAFREIKYEDRGTQTPSPVLPLPNNMLPCGVAQEPRPLFYGNAGFRLHFPAQFERVGDQGPLG
ERGGMERLNRQPQLPARSIEVCIGQKLQLIGDQFHQEHLQVVRIPTVTDCTAQLKSTEQAYCTQRSAERETEQQKWLLYG
HPLWSCLSVPCLFWLVSEHALAQCSDLSFYPPKT
>gnl|bcl2dbpro|A0A8C7HIL6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Oncorhynchus kisutch GN=BCL2L11 (length=214 residues).
MSDSSRRQNQSNGSTILIERGKYGELNPGGGAASGAEPTDNPQFSEGEQQSRGGIMMPNSLLGFQSRSPLFRTLSRSSSG
YFSFDSDSIPSSPLLKDKSTQTPSPSSQVMTHALQRMSQAQETNRDYDAWPNPLHPYRPRPPSTAGDMWPETLIGQELQR
IGDEFNDLFIHGRLAGRNGHVAQANLQEMHQEPAFLLWMGLLIGRLLQIILQRR
>gnl|bcl2dbpro|A0A8C7HIL6_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Oncorhynchus kisutch GN=BCL2L11 (length=229 residues).
MTLHRQNNKNSLTLILDLSYRRQNQSNGSTILIERGKYGELNPGGGAASGAEPTDNPQFSEGEQQSRGGIMMPNSLLGFQ
SRSPLFRTLSRSSSGYFSFDSDSIPSSPLLKDKSTQTPSPSSQVMTHALQRMSQAQETNRDYDAWPNPLHPYRPRPPSTA
GDMWPETLIGQELQRIGDEFNDLFIHGRLAGRNGHVAQANLQEMHQEPAFLLWMGLLIGRLLQIILQRR
>gnl|bcl2dbpro|A0A8C7JEQ7_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Oncorhynchus kisutch GN=BMF (length=232 residues).
MRGTCLSVSLSNRLTHTSVSHHFSCLSPVGRLPLRLPMDDEEEDMSLQRPVSQCWGTPFREIKFHDRESRDREDTQDRST
QTSTGPNAIVPRSEGHGIMVPQGHNNNNNFPCGVQDNHQGRILFHGNAGFRLHFPARFEPMDDRGERRNEEEEERRRMEE
RPEEERVEDSAEARIGRKLREIGDQFHQEHVQLFLRHQRDVLPVWIRLTMALYGFLFNREAPAVPRLRGQER
>gnl|bcl2dbpro|A0A8C7JEQ7_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oncorhynchus kisutch GN=BMF (length=195 residues).
MDDEEEDMSLQRPVSQCWGTPFREIKFHDRESRDREDTQDRSTQTSTGPNAIVPRSEGHGIMVPQGHNNNNNFPCGVQDN
HQGRILFHGNAGFRLHFPARFEPMDDRGERRNEEEEERRRMEERPEEERVEDSAEARIGRKLREIGDQFHQEHVQLFLRH
QRDVLPVWIRLTMALYGFLFNREAPAVPRLRGQER
>gnl|bcl2dbpro|A0A8C7KHU4_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oncorhynchus kisutch GN=BAD (length=147 residues).
MDHIHDCVDECESDHSGTTHNSEFQLHVSTTMSNRPRPGERVRLYSESQVCSQVGKREDTEFLDVMTPTEDGGGDGASFR
GRSQSAPPALWAAKKYGCQLRRMSDEFDTWLDKGEPKRGISPGGGKQKVSRGWFSFLWSPKEAEGRE
>gnl|bcl2dbpro|A0A8C7KKS5_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oncorhynchus kisutch GN=BAD (length=142 residues).
MNEQDESDHSGTTHYPEFQLHNVSATTSIRPRPGGRARLYSESQVCSQVGRRDDTEFQDAITPTEEGGGDGAPFRSRSQS
APPTLWAAKKYGRQLRRMSDEFDTWLDKGEPKRGISPGGVKQEVSRGWFSFLWSPNEAEGRE
>gnl|bcl2dbpro|A0A8C7L4D1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Oncorhynchus kisutch GN=BCL2L11 (length=195 residues).
FYYGESHPGGGAASRAEPSDNPQSCEGDQQSRGGIMIPNSLLGFQSRSPVFRTLSRSSSGYFSFDSDSIPSSPLLKDNKS
TQTPSPSSQVITHALQRMSRALETRRDYDVWPNPLRPYRASPPPTAADMRPEILIGQELQRIGDEFNNLFIHGRLAGRNG
QVAQGNLQQMHQEPAFLLWMGLLIGRLLQIILRRR
© 1998-2022Legal notice