Dataset for protein classical BH3-containing proteins of organism Oncorhynchus kisutch

[Download (right click)] [Edit] [Sequences] [Repertoires]

13 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C7FH91_BMF-01       --------------------------------------------------
A0A8C7JEQ7_BMF-02       --------------------------------------------------
A0A8C7HIL6_BCL2L11      --------------------------------------------------
A0A8C7HIL6_BCL2L11      --------------------------------------------------
A0A8C7L4D1_BCL2L11      --------------------------------------------------
A0A8C7JEQ7_BMF-01       --------------------------------------------------
A0A8C7G467_BMF-01       --------------------------------------------------
A0A8C7G467_BMF-02       --------------------------------------------------
A0A8C7KHU4_BAD-01       --------------------------------------------------
A0A8C7KKS5_BAD-01       --------------------------------------------------
A0A8C7DT45_BAD-01       --------------------------------------------------
A0A8C7DT45_BAD-02       --------------------------------------------------
A0A8C7DT45_BAD-03       MPRLSWPPELKLGTKIQGLFRVKHMCNNVVFLSSLPLFSFSPLSALSPSL
                                                                          

A0A8C7FH91_BMF-01       --------------------------------------------------
A0A8C7JEQ7_BMF-02       --------------------------------------------------
A0A8C7HIL6_BCL2L11      --------------------------------------------------
A0A8C7HIL6_BCL2L11      --------------------------------------------------
A0A8C7L4D1_BCL2L11      --------------------------------------------------
A0A8C7JEQ7_BMF-01       --------------------------------------------------
A0A8C7G467_BMF-01       --------------------------------------------------
A0A8C7G467_BMF-02       --------------------------------------------------
A0A8C7KHU4_BAD-01       --------------------------------------------------
A0A8C7KKS5_BAD-01       --------------------------------------------------
A0A8C7DT45_BAD-01       --------------------------------------------------
A0A8C7DT45_BAD-02       --------------------------------------------------
A0A8C7DT45_BAD-03       FLSLCPLSLPSLSALSRSPLSLSIPLPLSLPSLSPSLFLSLCPLSLSPSL
                                                                          

A0A8C7FH91_BMF-01       --------------------------------------------------
A0A8C7JEQ7_BMF-02       --------------------------------------------------
A0A8C7HIL6_BCL2L11      --------------------------------------------------
A0A8C7HIL6_BCL2L11      --------------------------------------------------
A0A8C7L4D1_BCL2L11      --------------------------------------------------
A0A8C7JEQ7_BMF-01       --------------------------------------------------
A0A8C7G467_BMF-01       --------------------------------------------------
A0A8C7G467_BMF-02       --------------------------------------------------
A0A8C7KHU4_BAD-01       --------------------------------------------------
A0A8C7KKS5_BAD-01       --------------------------------------------------
A0A8C7DT45_BAD-01       --------------------------------------------------
A0A8C7DT45_BAD-02       --------------------------------------------------
A0A8C7DT45_BAD-03       FLSLCPLSLSPSLFLSLCPLSLSPSLFPSLSALSLSLHPSSPLSLHPSSP
                                                                          

A0A8C7FH91_BMF-01       ------------------------------------------MDDEEDDV
A0A8C7JEQ7_BMF-02       -----MRGTCLSVSLSNRLTHTSVSHHFSCLSPVGRLPLRLPMDDEEEDM
A0A8C7HIL6_BCL2L11      -------------------------------MTLHRQNNKNSLTLILDLS
A0A8C7HIL6_BCL2L11      ----------------------------------------------MSDS
A0A8C7L4D1_BCL2L11      --------------------------------------------------
A0A8C7JEQ7_BMF-01       ------------------------------------------MDDEEEDM
A0A8C7G467_BMF-01       ------------------------------------------MDDEEDDV
A0A8C7G467_BMF-02       ------------------------------------------MDDEEDDV
A0A8C7KHU4_BAD-01       ------------------------------------------------MD
A0A8C7KKS5_BAD-01       --------------------------------------------------
A0A8C7DT45_BAD-01       ----------------------------------------------MAQM
A0A8C7DT45_BAD-02       ----------------------------------------------MAQM
A0A8C7DT45_BAD-03       LSLPSLLSLCPLSSLSALSPSLSIPLPLSLSIPLPLLTHSSSIDVSMAQM
                                                                          

A0A8C7FH91_BMF-01       FV-PDSSHCWRTAFREIKYEDRGTQT--------------PSPALALP--
A0A8C7JEQ7_BMF-02       SLQRPVSQCWGTPFREIKFHDRESRDREDTQDRSTQTSTGPNAIVPRSEG
A0A8C7HIL6_BCL2L11      YRRQNQSNGSTILIERGKYGELNPGG------------GAASGAEPTDNP
A0A8C7HIL6_BCL2L11      SRRQNQSNGSTILIERGKYGELNPGG------------GAASGAEPTDNP
A0A8C7L4D1_BCL2L11      ----------------FYYGESHPGG------------GAASRAEPSDNP
A0A8C7JEQ7_BMF-01       SLQRPVSQCWGTPFREIKFHDRESRDREDTQDRSTQTSTGPNAIVPRSEG
A0A8C7G467_BMF-01       F--EPDSRCWRTAFREIKYEDRGTQT--------------PSPVLPLP--
A0A8C7G467_BMF-02       F--EPDSRCWRTAFREIKYEDRGTQT--------------PSPVLPLP--
A0A8C7KHU4_BAD-01       HIHDCVDECESDHSGTTHNSEFQL--------------------------
A0A8C7KKS5_BAD-01       ----MNEQDESDHSGTTHYPEFQ---------------------------
A0A8C7DT45_BAD-01       FTISDSESEPSEEVGETEKDQSSAGK------------------------
A0A8C7DT45_BAD-02       FTISDSESEPSEEVGETEKDQSSAGK------------------------
A0A8C7DT45_BAD-03       FTISDSESEPSEEVGETEKDQSSAGK------------------------
                                            :                             

A0A8C7FH91_BMF-01       -----------NDMLPCGV--AQEPRPLF----YGNAGFRLHFPARFEQV
A0A8C7JEQ7_BMF-02       HGIMVPQGHNNNNNFPCGVQDNHQGRILF----HGNAGFRLHFPARFEPM
A0A8C7HIL6_BCL2L11      QFSEGEQQSRGGIMMPNSLLGFQSRSPLFRTLSRSSSGY---FSFDSDSI
A0A8C7HIL6_BCL2L11      QFSEGEQQSRGGIMMPNSLLGFQSRSPLFRTLSRSSSGY---FSFDSDSI
A0A8C7L4D1_BCL2L11      QSCEGDQQSRGGIMIPNSLLGFQSRSPVFRTLSRSSSGY---FSFDSDSI
A0A8C7JEQ7_BMF-01       HGIMVPQGHNNNNNFPCGVQDNHQGRILF----HGNAGFRLHFPARFEPM
A0A8C7G467_BMF-01       -----------NNMLPCGV--AQEPRPLF----YGNAGFRLHFPAQFERV
A0A8C7G467_BMF-02       -----------NNMLPCGV--AQEPRPLF----YGNAGFRLHFPAQFERV
A0A8C7KHU4_BAD-01       -------------------------HVSTTMSNRPRPGERVRLYSESQVC
A0A8C7KKS5_BAD-01       -----------------------LHNVSATTSIRPRPGGRARLYSESQVC
A0A8C7DT45_BAD-01       -----------------GMTGGPIGHALTVPEMRLAGEGRLRMNSESQAQ
A0A8C7DT45_BAD-02       -----------------GMTGGPIGHALTVPEMRLAGEGRLRMNSESQAQ
A0A8C7DT45_BAD-03       -----------------GMTGGPIGHALTVPEMRLAGEGRLRMNSESQAQ
                                                                  :    :  

A0A8C7FH91_BMF-01       GDQGPQEQ----------HQVERGRMERLQQ------------------Q
A0A8C7JEQ7_BMF-02       DDRGERRN--------------EEEEERRRM------------------E
A0A8C7HIL6_BCL2L11      PSSPLLKD-KSTQTPSPSSQVMTHALQRMSQAQETNRDYDAWPNPLHPYR
A0A8C7HIL6_BCL2L11      PSSPLLKD-KSTQTPSPSSQVMTHALQRMSQAQETNRDYDAWPNPLHPYR
A0A8C7L4D1_BCL2L11      PSSPLLKDNKSTQTPSPSSQVITHALQRMSRALETRRDYDVWPNPLRPYR
A0A8C7JEQ7_BMF-01       DDRGERRN--------------EEEEERRRM------------------E
A0A8C7G467_BMF-01       GDQGPLGE--------------RGGMERLNR------------------Q
A0A8C7G467_BMF-02       GDQGPLGE--------------RGGMERLNR------------------Q
A0A8C7KHU4_BAD-01       SQVGKRED--------------TEFLDVMTPTEDGGGDGASF-------R
A0A8C7KKS5_BAD-01       SQVGRRDD--------------TEFQDAITPTEEGGGDGAPF-------R
A0A8C7DT45_BAD-01       ELQGRGPG--------------VEGMPT---------DGASF-------R
A0A8C7DT45_BAD-02       ELQGRGPG--------------VEGMPT---------DGASF-------R
A0A8C7DT45_BAD-03       ELQGRGPG--------------VEGMPT---------DGASF-------R
                                                                          

A0A8C7FH91_BMF-01       PQQPAQSM----EVCIGQKLQLIGDQFYQEHLQL----------------
A0A8C7JEQ7_BMF-02       ERPEEERVEDSAEARIGRKLREIGDQFHQEHVQL----------------
A0A8C7HIL6_BCL2L11      PRPPSTAGDMWPETLIGQELQRIGDEFNDLFIHG----------------
A0A8C7HIL6_BCL2L11      PRPPSTAGDMWPETLIGQELQRIGDEFNDLFIHG----------------
A0A8C7L4D1_BCL2L11      ASPPPTAADMRPEILIGQELQRIGDEFNNLFIHG----------------
A0A8C7JEQ7_BMF-01       ERPEEERVEDSAEARIGRKLREIGDQFHQEHVQL----------------
A0A8C7G467_BMF-01       PQLPARSI----EVCIGQKLQLIGDQFHQEHLQV----------------
A0A8C7G467_BMF-02       PQLPARSI----EVCIGQKLQLIGDQFHQEHLQVVRIPTVTDCTAQLKST
A0A8C7KHU4_BAD-01       GRSQSAPPALWAAKKYGCQLRRMSDEFD----------------------
A0A8C7KKS5_BAD-01       SRSQSAPPTLWAAKKYGRQLRRMSDEFD----------------------
A0A8C7DT45_BAD-01       GRSQSAPPALWAAKRYGRQLRRMSDEFD----------------------
A0A8C7DT45_BAD-02       GRSQSAPPALWAAKRYGRQLRRMSDEFD----------------------
A0A8C7DT45_BAD-03       GRSQSAPPALWAAKRYGRQLRRMSDEFD----------------------
                                        * :*. :.*:*                       

A0A8C7FH91_BMF-01       ---YHRNQRNMR------------PLWWRLASAL----------------
A0A8C7JEQ7_BMF-02       ---FLRHQRDVL------------PVWIRLTMAL----------------
A0A8C7HIL6_BCL2L11      -RLAGRNGHVAQANLQEMHQEPAFLLWMGLLIGR----------------
A0A8C7HIL6_BCL2L11      -RLAGRNGHVAQANLQEMHQEPAFLLWMGLLIGR----------------
A0A8C7L4D1_BCL2L11      -RLAGRNGQVAQGNLQQMHQEPAFLLWMGLLIGR----------------
A0A8C7JEQ7_BMF-01       ---FLRHQRDVL------------PVWIRLTMAL----------------
A0A8C7G467_BMF-01       ---YHRNQRNMR------------PLWWRLASAL----------------
A0A8C7G467_BMF-02       EQAYCTQRSAERETEQQKWLLYGHPLWSCLSVPC----------------
A0A8C7KHU4_BAD-01       -TWLDKGEPKRGISPGGGKQKV-SRGWFSFLWSPKEAEGRE---------
A0A8C7KKS5_BAD-01       -TWLDKGEPKRGISPGGVKQEV-SRGWFSFLWSPNEAEGRE---------
A0A8C7DT45_BAD-01       -TWLDKGRC------------------YCKVFRCSPNQ------------
A0A8C7DT45_BAD-02       -TWLDKGEMRRVKSAGAAKQMTKSPSWWAYLFSHKETERWRRERIGRRGG
A0A8C7DT45_BAD-03       -TWLDKGEMRRVKSAGAAKQMTKSPSWWAYLFSHKETE------------
                                                                          

A0A8C7FH91_BMF-01       --------------LTLLFEQEAIAGRGRAGWR----
A0A8C7JEQ7_BMF-02       --------------YGFLFNREAPAV---PRLRGQER
A0A8C7HIL6_BCL2L11      --------------LLQIILQRR--------------
A0A8C7HIL6_BCL2L11      --------------LLQIILQRR--------------
A0A8C7L4D1_BCL2L11      --------------LLQIILRRR--------------
A0A8C7JEQ7_BMF-01       --------------YGFLFNREAPAV---PRLRGQER
A0A8C7G467_BMF-01       --------------LTLLFEQEAIAGGGRAGWR----
A0A8C7G467_BMF-02       --------------LFWLVSEHALAQCSDLSFYPPKT
A0A8C7KHU4_BAD-01       -------------------------------------
A0A8C7KKS5_BAD-01       -------------------------------------
A0A8C7DT45_BAD-01       --------------PPTLPGGPNSFPIPSMLGAG---
A0A8C7DT45_BAD-02       WAYLFSHQETTHRNRTTIEPRSSEYREGDVSHANKAP
A0A8C7DT45_BAD-03       -----------TEHTPIIPPRSSE-------------
                                                             

© 1998-2022Legal notice