Dataset for protein Bmf of organism Oncorhynchus kisutch

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                     *****:*:      *.** *.*****: ** :.          
mrgtclsvslsnrlthtsvshhfsclspvgrlplrlp     e mslqedd q  g p     fh  esrdredtqdrst
                                              v p s h                           

        90       100       110       120       130       140       150       160
     *.. :. .             *: :****   :: * **:***********.** :.*.*       :    ** 
qtstg naivarseghgimvpqghnn dnf    qdnhqg i  h           q  pmd r elgqhqvneeee  r
        a                                                  q      qe       r    

       170       180       190       200       210       220       230       240
. : .     :    *. **.**. *****:***:*:                   :  :.                *:*
nmeerleeeriedsa ar  r  re     y   v vvriptvtdctaqlksteqafhthrsdmleteqqkwllygh v 
qq   q  q m                                              q  ae                

       250       260       270
  *: .    *..  * *            
ic ampcygf veqh i grgraglygqer
 sv   fw  s l qgsdlsf ppkt
© 1998-2023Legal notice