Dataset for protein Bmf of organism Oncorhynchus kisutch

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A8C7FH91_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oncorhynchus kisutch GN=BMF (length=164 residues).
MDDEEDDVFVPDSSHCWRTAFREIKYEDRGTQTPSPALALPNDMLPCGVAQEPRPLFYGNAGFRLHFPARFEQVGDQGPQ
EQHQVERGRMERLQQQPQQPAQSMEVCIGQKLQLIGDQFYQEHLQLYHRNQRNMRPLWWRLASALLTLLFEQEAIAGRGR
AGWR
>gnl|bcl2dbpro|A0A8C7G467_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oncorhynchus kisutch GN=BMF (length=159 residues).
MDDEEDDVFEPDSRCWRTAFREIKYEDRGTQTPSPVLPLPNNMLPCGVAQEPRPLFYGNAGFRLHFPAQFERVGDQGPLG
ERGGMERLNRQPQLPARSIEVCIGQKLQLIGDQFHQEHLQVYHRNQRNMRPLWWRLASALLTLLFEQEAIAGGGRAGWR
>gnl|bcl2dbpro|A0A8C7G467_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Oncorhynchus kisutch GN=BMF (length=194 residues).
MDDEEDDVFEPDSRCWRTAFREIKYEDRGTQTPSPVLPLPNNMLPCGVAQEPRPLFYGNAGFRLHFPAQFERVGDQGPLG
ERGGMERLNRQPQLPARSIEVCIGQKLQLIGDQFHQEHLQVVRIPTVTDCTAQLKSTEQAYCTQRSAERETEQQKWLLYG
HPLWSCLSVPCLFWLVSEHALAQCSDLSFYPPKT
>gnl|bcl2dbpro|A0A8C7JEQ7_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Oncorhynchus kisutch GN=BMF (length=232 residues).
MRGTCLSVSLSNRLTHTSVSHHFSCLSPVGRLPLRLPMDDEEEDMSLQRPVSQCWGTPFREIKFHDRESRDREDTQDRST
QTSTGPNAIVPRSEGHGIMVPQGHNNNNNFPCGVQDNHQGRILFHGNAGFRLHFPARFEPMDDRGERRNEEEEERRRMEE
RPEEERVEDSAEARIGRKLREIGDQFHQEHVQLFLRHQRDVLPVWIRLTMALYGFLFNREAPAVPRLRGQER
>gnl|bcl2dbpro|A0A8C7JEQ7_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oncorhynchus kisutch GN=BMF (length=195 residues).
MDDEEEDMSLQRPVSQCWGTPFREIKFHDRESRDREDTQDRSTQTSTGPNAIVPRSEGHGIMVPQGHNNNNNFPCGVQDN
HQGRILFHGNAGFRLHFPARFEPMDDRGERRNEEEEERRRMEERPEEERVEDSAEARIGRKLREIGDQFHQEHVQLFLRH
QRDVLPVWIRLTMALYGFLFNREAPAVPRLRGQER
© 1998-2022Legal notice