Dataset for protein Bmf of organism Oncorhynchus kisutch

[Download (right click)] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A8C7JEQ7_BMF-02      MRGTCLSVSLSNRLTHTSVSHHFSCLSPVGRLPLRLPMDDEEEDMSLQRP
A0A8C7G467_BMF-01      -------------------------------------MDDEEDDVF--EP
A0A8C7FH91_BMF-01      -------------------------------------MDDEEDDVF--VP
A0A8C7G467_BMF-02      -------------------------------------MDDEEDDVF--EP
A0A8C7JEQ7_BMF-01      -------------------------------------MDDEEEDMSLQRP
                                                            *****:*:    *

A0A8C7JEQ7_BMF-02      VS-QCWGTPFREIKFHDRESRDREDTQDRSTQTSTGPNAIVPRSEGHGIM
A0A8C7G467_BMF-01      DS-RCWRTAFREIKYEDR-----------GTQTP---SPVLP--------
A0A8C7FH91_BMF-01      DSSHCWRTAFREIKYEDR-----------GTQTP---SPALA--------
A0A8C7G467_BMF-02      DS-RCWRTAFREIKYEDR-----------GTQTP---SPVLP--------
A0A8C7JEQ7_BMF-01      VS-QCWGTPFREIKFHDRESRDREDTQDRSTQTSTGPNAIVPRSEGHGIM
                        * :** *.*****:.**           .***.   .. :.        

A0A8C7JEQ7_BMF-02      VPQGHNNNNNFPCGVQDNHQGRILFHGNAGFRLHFPARFEPMDDRGERRN
A0A8C7G467_BMF-01      -----LPNNMLPCGVA--QEPRPLFYGNAGFRLHFPAQFERVGDQGPL--
A0A8C7FH91_BMF-01      -----LPNDMLPCGVA--QEPRPLFYGNAGFRLHFPARFEQVGDQGPQEQ
A0A8C7G467_BMF-02      -----LPNNMLPCGVA--QEPRPLFYGNAGFRLHFPAQFERVGDQGPL--
A0A8C7JEQ7_BMF-01      VPQGHNNNNNFPCGVQDNHQGRILFHGNAGFRLHFPARFEPMDDRGERRN
                              *: :****   :: * **:***********:** :.*:*    

A0A8C7JEQ7_BMF-02      EEEEERRRMEERPEE-ERVEDSAEARIGRKLREIGDQFHQEHVQLFLR--
A0A8C7G467_BMF-01      ---GERGGMERLNRQPQLPARSIEVCIGQKLQLIGDQFHQEHLQVYHR--
A0A8C7FH91_BMF-01      -HQVERGRMERLQQQPQQPAQSMEVCIGQKLQLIGDQFYQEHLQLYHR--
A0A8C7G467_BMF-02      ---GERGGMERLNRQPQLPARSIEVCIGQKLQLIGDQFHQEHLQVVRIPT
A0A8C7JEQ7_BMF-01      EEEEERRRMEERPEE-ERVEDSAEARIGRKLREIGDQFHQEHVQLFLR--
                           **  **.  .: :    * *. **:**: *****:***:*:     

A0A8C7JEQ7_BMF-02      ----------------HQR-------------DVLPVWIRLTMALYGFLF
A0A8C7G467_BMF-01      ----------------NQR-------------NMRPLWWRLASALLTLLF
A0A8C7FH91_BMF-01      ----------------NQR-------------NMRPLWWRLASALLTLLF
A0A8C7G467_BMF-02      VTDCTAQLKSTEQAYCTQRSAERETEQQKWLLYGHPLWSCLSVPCLFWLV
A0A8C7JEQ7_BMF-01      ----------------HQR-------------DVLPVWIRLTMALYGFLF
                                        **                *:*  *: .    *.

A0A8C7JEQ7_BMF-02      NREAPAVPRLRGQE----R
A0A8C7G467_BMF-01      EQEAIAG-GGRAGW----R
A0A8C7FH91_BMF-01      EQEAIAG-RGRAGW----R
A0A8C7G467_BMF-02      SEHALAQ-CSDLSFYPPKT
A0A8C7JEQ7_BMF-01      NREAPAVPRLRGQE----R
                       ...* *             

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice