Dataset for protein Bmf of organism Oncorhynchus kisutch

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C7JEQ7_BMF-02      MRGTCLSVSLSNRLTHTSVSHHFSCLSPVGRLPLRLPMDDEEEDMSLQRP
A0A8C7FH91_BMF-01      -------------------------------------MDDEEDDVFV-PD
A0A8C7JEQ7_BMF-01      -------------------------------------MDDEEEDMSLQRP
A0A8C7G467_BMF-01      -------------------------------------MDDEEDDVF--EP
A0A8C7G467_BMF-02      -------------------------------------MDDEEDDVF--EP
                                                            *****:*:     

A0A8C7JEQ7_BMF-02      VSQCWGTPFREIKFHDRESRDREDTQDRSTQTSTGPNAIVPRSEGHGIMV
A0A8C7FH91_BMF-01      SSHCWRTAFREIKYEDRGTQT--------------PSPALALP-------
A0A8C7JEQ7_BMF-01      VSQCWGTPFREIKFHDRESRDREDTQDRSTQTSTGPNAIVPRSEGHGIMV
A0A8C7G467_BMF-01      DSRCWRTAFREIKYEDRGTQT--------------PSPVLPLP-------
A0A8C7G467_BMF-02      DSRCWRTAFREIKYEDRGTQT--------------PSPVLPLP-------
                        *.** *.*****: ** :.               *.. :. .       

A0A8C7JEQ7_BMF-02      PQGHNNNNNFPCGVQDNHQGRILFHGNAGFRLHFPARFEPMDDRGERR--
A0A8C7FH91_BMF-01      ------NDMLPCGV--AQEPRPLFYGNAGFRLHFPARFEQVGDQGPQEQH
A0A8C7JEQ7_BMF-01      PQGHNNNNNFPCGVQDNHQGRILFHGNAGFRLHFPARFEPMDDRGERR--
A0A8C7G467_BMF-01      ------NNMLPCGV--AQEPRPLFYGNAGFRLHFPAQFERVGDQGPLG--
A0A8C7G467_BMF-02      ------NNMLPCGV--AQEPRPLFYGNAGFRLHFPAQFERVGDQGPLG--
                             *: :****   :: * **:***********.** :.*.*     

A0A8C7JEQ7_BMF-02      --NEEEEERRRMEERPEEERVEDSAEARIGRKLREIGDQFHQEHVQL---
A0A8C7FH91_BMF-01      QVERGRMERLQQQPQQPAQSM----EVCIGQKLQLIGDQFYQEHLQL---
A0A8C7JEQ7_BMF-01      --NEEEEERRRMEERPEEERVEDSAEARIGRKLREIGDQFHQEHVQL---
A0A8C7G467_BMF-01      --ERGGMERLNRQPQLPARSI----EVCIGQKLQLIGDQFHQEHLQV---
A0A8C7G467_BMF-02      --ERGGMERLNRQPQLPARSI----EVCIGQKLQLIGDQFHQEHLQVVRI
                         :    ** . : .     :    *. **.**. *****:***:*:   

A0A8C7JEQ7_BMF-02      ----------------FLRHQRDVL------------PVWIRLTMALYGF
A0A8C7FH91_BMF-01      ----------------YHRNQRNMR------------PLWWRLASALLTL
A0A8C7JEQ7_BMF-01      ----------------FLRHQRDVL------------PVWIRLTMALYGF
A0A8C7G467_BMF-01      ----------------YHRNQRNMR------------PLWWRLASALLTL
A0A8C7G467_BMF-02      PTVTDCTAQLKSTEQAYCTQRSAERETEQQKWLLYGHPLWSCLSVPCLFW
                                       :  :.                *:*  *: .    

A0A8C7JEQ7_BMF-02      LFNREAPAV---PRLRGQER
A0A8C7FH91_BMF-01      LFEQEAIAGRGRAGWR----
A0A8C7JEQ7_BMF-01      LFNREAPAV---PRLRGQER
A0A8C7G467_BMF-01      LFEQEAIAGGGRAGWR----
A0A8C7G467_BMF-02      LVSEHALAQCSDLSFYPPKT
                       *..  * *            

© 1998-2022Legal notice