Dataset for protein Bad of organism Oncorhynchus kisutch

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mprlswppelklgtkiqglfrvkhmcnnvvflsslplfsfsplsalspslflslcplslpslsalsrsplslsiplplsl
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
pslspslflslcplslspslflslcplslspslflslcplslspslfpslsalslslhpssplslhpssplslpsllslc
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                              :.  *:  * *   : .           :. :. 
------------------------------------maqmftisdsesepSeevGeTekdqssagkgmtggpighaltvp
plsslsalspslsiplplslsiplpllthsssidvs--------mvdqde dhs t hysefq-----------nvsatt
                                      mdhihdcn e        np   l        lh     m
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
. *     * *: ****. .  *.  ..*   .         ***.**.*******:*****.** **************
emRlagegRlRmnSESQaqelqGrgpgvEgmpt---------DGAsFRgRSQSAPPaLWAAKrYGrQLRRMSDEFDTWLD
sn prpge v ly    vcsqv kredt fqdvmtpteeggg   p  s       t     k  c              
 i       a               d    l ai    d                                         
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**                    :. ::  .  :                                               
KGeprrvkspggakqmv-srswwsylfspkete-----------------------------------------------
  rmk-gi-a-a----tk-pg-fafvwrhspaqgrererigrrggwaylfshqetttrntptipprsseyripsvshank
   c- -- - -v  k-  -- yck   cn n rwr                    hehrtileggpnsfpegdmlg g 
            g  e                                           p                    

  
..
  
--
ap
  
  
© 1998-2022Legal notice