Dataset for protein Bad of organism Oncorhynchus kisutch

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A8C7DT45_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oncorhynchus kisutch GN=BAD (length=197 residues).
MAQMFTISDSESEPSEEVGETEKDQSSAGKGMTGGPIGHALTVPEMRLAGEGRLRMNSESQAQELQGRGPGVEGMPTDGA
SFRGRSQSAPPALWAAKRYGRQLRRMSDEFDTWLDKGEMRRVKSAGAAKQMTKSPSWWAYLFSHKETERWRRERIGRRGG
WAYLFSHQETTHRNRTTIEPRSSEYREGDVSHANKAP
>gnl|bcl2dbpro|A0A8C7DT45_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oncorhynchus kisutch GN=BAD (length=150 residues).
MAQMFTISDSESEPSEEVGETEKDQSSAGKGMTGGPIGHALTVPEMRLAGEGRLRMNSESQAQELQGRGPGVEGMPTDGA
SFRGRSQSAPPALWAAKRYGRQLRRMSDEFDTWLDKGRCYCKVFRCSPNQPPTLPGGPNSFPIPSMLGAG
>gnl|bcl2dbpro|A0A8C7DT45_BAD-03 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oncorhynchus kisutch GN=BAD (length=357 residues).
MPRLSWPPELKLGTKIQGLFRVKHMCNNVVFLSSLPLFSFSPLSALSPSLFLSLCPLSLPSLSALSRSPLSLSIPLPLSL
PSLSPSLFLSLCPLSLSPSLFLSLCPLSLSPSLFLSLCPLSLSPSLFPSLSALSLSLHPSSPLSLHPSSPLSLPSLLSLC
PLSSLSALSPSLSIPLPLSLSIPLPLLTHSSSIDVSMAQMFTISDSESEPSEEVGETEKDQSSAGKGMTGGPIGHALTVP
EMRLAGEGRLRMNSESQAQELQGRGPGVEGMPTDGASFRGRSQSAPPALWAAKRYGRQLRRMSDEFDTWLDKGEMRRVKS
AGAAKQMTKSPSWWAYLFSHKETETEHTPIIPPRSSE
>gnl|bcl2dbpro|A0A8C7KHU4_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oncorhynchus kisutch GN=BAD (length=147 residues).
MDHIHDCVDECESDHSGTTHNSEFQLHVSTTMSNRPRPGERVRLYSESQVCSQVGKREDTEFLDVMTPTEDGGGDGASFR
GRSQSAPPALWAAKKYGCQLRRMSDEFDTWLDKGEPKRGISPGGGKQKVSRGWFSFLWSPKEAEGRE
>gnl|bcl2dbpro|A0A8C7KKS5_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oncorhynchus kisutch GN=BAD (length=142 residues).
MNEQDESDHSGTTHYPEFQLHNVSATTSIRPRPGGRARLYSESQVCSQVGRRDDTEFQDAITPTEEGGGDGAPFRSRSQS
APPTLWAAKKYGRQLRRMSDEFDTWLDKGEPKRGISPGGVKQEVSRGWFSFLWSPNEAEGRE
© 1998-2022Legal notice